KEGG   Acidovorax ebreus: Dtpsy_1172
Entry
Dtpsy_1172        CDS       T00853                                 

Definition
(GenBank) plasmid conserved hypothetical protein RAQPRD
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: Plasmid_RAQPRD
Other DBs
NCBI-ProteinID: ACM32644
UniProt: B9MG53
Position
complement(1233045..1233425)
AA seq 126 aa
MLAPIWQRAAHRGVPIFLVTALLLGQSPMALAESPAQRQELVAALRQLDALERTVADSAA
RAPIQPGERYHFDYPRLLADLARVRAGIQAHLTPSRAQPRDPSELASDYRTERSASPSPT
TTEAKP
NT seq 381 nt   +upstreamnt  +downstreamnt
atgttggctccgatctggcagcgcgccgcgcatcgcggcgtgcccatttttctcgtgacg
gccctgctgctgggtcagtccccgatggcgttggccgagtcccccgcacagcgccaggag
ctggtcgccgcgctgcgccaactcgacgcgctggagcgcaccgtcgccgacagcgccgcg
cgtgcccccatccagccgggcgagcgctaccacttcgattacccgcggttgctggctgac
ttggcgcgcgtgcgcgccggcatccaggcccatctcacaccgtcgcgtgcccagccgcgc
gacccctccgaactggccagcgactaccgcaccgagcggtccgcttcgccatcgccgacg
actacggaagccaagccatga

DBGET integrated database retrieval system