KEGG   Acidovorax ebreus: Dtpsy_1175
Entry
Dtpsy_1175        CDS       T00853                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: TraG-D_C TrwB_AAD_bind
Other DBs
NCBI-ProteinID: ACM32647
UniProt: B9MG56
Position
complement(1235368..1236240)
AA seq 290 aa
MSGKQPVEVLLRPAVELYTVAACAGAAFLSLVAPWSLALSPSMGVGSALAFGAYGGLPGA
SAGARVPINVHADEFNELMGDEFIPLINKGGGAGLQVTAYTQTLSDIEARIGNRAKAGQV
IGNFNNLFMLRVRETATAELLTRQLPKVEVYTTTIVSGATDSSDIRGATDFTSNTQDRIS
MSSVPMIEPSHVVGLPKGQCFALLQGGQLWKVRMPLPAPDPDEVMPADLQQLAGYMRQSY
SEATQWWEFTSSPALQDTGLPDDLLDDAAAAEPPAVAIATDEDTGNKASP
NT seq 873 nt   +upstreamnt  +downstreamnt
atgtcggggaaacagccggtcgaggtactgcttcgcccagcggtggagctatacaccgtt
gccgcatgcgcgggcgccgcgtttctgtccctggtggccccatggtcgctcgcgctgagc
ccgtccatgggcgtcggcagcgcgctggcgttcggcgcctacggtggcctgccgggcgca
tcggccggtgcgcgcgtgccgatcaacgtccatgccgacgagttcaacgaattgatgggc
gacgagttcatcccgctgatcaacaagggcggcggtgccggcctgcaagtcactgcgtac
acgcagaccctgtcggacatcgaggcccgcatcggcaaccgcgcgaaggcaggccaggtg
atcgggaatttcaacaacctgttcatgctgcgcgtgcgcgagaccgcgaccgccgaactg
ctgacccggcaattgccgaaggtcgaggtctatacgaccaccatcgtcagcggcgcgacc
gacagctcggacattcgcggggcgacggatttcacgtcgaacactcaggaccgcatcagc
atgtccagcgtgccgatgatcgagccgtcgcacgtcgtcggcctgccgaaaggccagtgc
ttcgcgttgctgcagggcggccagctttggaaagtgcgcatgccgctgccggcgccggac
ccggacgaagtgatgccggcagacttgcagcaactggccgggtacatgcgccagagctac
agcgaagcgacgcagtggtgggagttcaccagttcccccgccttgcaggacacgggcctg
cccgacgacctgctggatgacgccgctgcggccgaacctcccgcggtggccattgccacc
gacgaggacaccggcaacaaggcctcgccatga

DBGET integrated database retrieval system