KEGG   Acidovorax ebreus: Dtpsy_1177
Entry
Dtpsy_1177        CDS       T00853                                 

Definition
(GenBank) Lytic transglycosylase catalytic
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: SLT Glucosaminidase SLT_3
Other DBs
NCBI-ProteinID: ACM32649
UniProt: B9MG58
Position
complement(1236781..1237371)
AA seq 196 aa
MAAPAIAAPLRTLVLAAGLCACVAQAQEVPPPAYQLAAQRAGIPSTVLYAVALQESGIRR
NGRIVPWPWSLNVAGQSRRYATRADACAGLQQAMRSTPHTRIDAGLGQINLGYHQQRYAS
ACDLLDPYRNLAIAAEILREQHAPGEDWLLAMGRYHRPAGGEPAARYRRSVSRHLARVQG
ARPTAAVLAARKETSP
NT seq 591 nt   +upstreamnt  +downstreamnt
atggcagcgccagccatagccgcccccctgcgcacactggtgctcgccgctggcctatgc
gcctgcgtcgcccaagcccaggaggttccgccaccggcctaccagctcgccgcgcagcgc
gcaggcatcccctcgacggtgctctacgccgtggccttgcaggagagtggcatccgccgt
aacggacgcatcgtcccgtggccgtggtccctcaacgtcgccggccaatcacgccgctat
gcgacccgcgccgatgcctgcgcgggtttgcagcaggcgatgcgctccacgccgcacacg
cgcatcgacgcgggcctgggccagatcaacctcggctaccaccagcagcgctacgccagc
gcctgcgacctgctcgacccgtaccggaatctcgccatcgctgccgagatcctgcgcgag
caacacgcccccggcgaggactggttgctggcgatgggccgctaccaccgccccgcgggt
ggcgagcccgccgcccgctaccggcgcagcgtgtcgcgccacctcgcccgggtgcagggc
gcacgcccaaccgccgcggttctcgccgcacgcaaggagacatccccatga

DBGET integrated database retrieval system