KEGG   Acidovorax ebreus: Dtpsy_1178
Entry
Dtpsy_1178        CDS       T00853                                 

Definition
(GenBank) putative secreted protein
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: Glutaredoxin
Other DBs
NCBI-ProteinID: ACM32650
UniProt: B9MG59
Position
complement(1237353..1238078)
AA seq 241 aa
MKPSIILSALLLASTQLPAWAQQSATAPARNAQSQERPLVARILDDRVASDWGLQPQEWA
RYRELMDGPLGIYSPNLDPLSALGIEARTEEERRRYAELQVQVEARRVEKLLAYQRAYDE
AWQRLNPGMQRVNLPDDKPVAGATRGSGRTAVFVKDNCVACGQLVQRLQSSGAEFDLYMV
GSRQDDARIRDWAKRANVDPARVRSGSITLNHDGGRWLTLGVPGDLPAVVREVNGQWQRQ
P
NT seq 726 nt   +upstreamnt  +downstreamnt
atgaagccgtcgatcatcctttccgcgcttctgctggcgtccacccagttgcccgcgtgg
gcgcagcaatccgccacggctcccgcccgcaatgcgcagagtcaggaacgcccgctggtc
gcccgcattctggacgaccgggtggcgagcgactggggccttcaacctcaggagtgggcg
cgctatcgcgaactgatggacggtccactgggcatctattcgcccaacctggacccgctg
tcggccctgggcatcgaggcgcgtaccgaagaggaacggcgacgctacgccgagctgcag
gtgcaggtcgaagcgcgccgcgtggagaaactgctcgcttatcagcgggcctatgacgag
gcctggcagcgcctgaaccccgggatgcagcgggtgaacctgccggacgacaagccggtc
gccggggccacgcgcggctccggccgcacggcagtgttcgtgaaagataactgcgtggcc
tgcggccagctcgtgcagcgcctgcaatcctcgggcgccgaattcgacctgtacatggtc
ggcagccgccaggacgacgcgcgcatccgcgattgggccaagcgcgcgaacgtcgatccg
gcgcgcgtgcgcagcggcagcatcacgctcaaccacgacggcggccgctggttgaccttg
ggggtacccggcgacctgccggcggtcgtgcgcgaggtgaacggccaatggcagcgccag
ccatag

DBGET integrated database retrieval system