KEGG   Acidovorax ebreus: Dtpsy_1180
Entry
Dtpsy_1180        CDS       T00853                                 

Definition
(GenBank) putative secreted protein
Organism
dia  Acidovorax ebreus
SSDB
Other DBs
NCBI-ProteinID: ACM32652
UniProt: B9MG61
Position
complement(1238731..1239330)
AA seq 199 aa
MCPSPPWFHHPERRLLAGFLGLLWSVLAGGCATTSAPVAPDTIEEVSAAPVPEAPEYIPV
VRYGRYTLVELAPTAAQRDLLLQTIDVSMPEDARATVGDGLRHVLKRSGYGLCQTTHAVI
ELYALPLPAAHLHLGPMTLRDALLTLAGSAWELHADDRARQICFERPGDSMTADNVPAPP
ATEAVQTFPLAPAASGGQP
NT seq 600 nt   +upstreamnt  +downstreamnt
atgtgcccctctccaccttggtttcaccatcccgaacgccgtctgctggcgggttttctc
ggcctgctttggtcggtgctggctggcggctgcgcgacgacgagcgcgccggtcgcgccc
gacaccatcgaggaagtctcggccgcacccgtacccgaggcgcccgaatacatccccgtt
gtgcgctacggccgctacaccctcgtggaactggcaccgacagcagcgcagcgcgacctg
ctgttgcagaccatcgacgtgtcgatgcccgaggatgcacgcgctacggtcggcgacggg
ctacggcatgtgctcaagcgcagcggttacggcttgtgccagacgacgcacgcggtgatc
gagctgtacgcactgccgctgccggcggcccacctgcacctcggccccatgaccctgcgg
gatgcgctgctcaccctggctggttcggcctgggaactgcacgcggatgaccgcgcgcgg
caaatctgcttcgagcggcccggcgacagcatgaccgccgacaacgtacccgcgccgcct
gccaccgaggcggtgcagacgttcccgctggcgcccgcggcatcgggaggccagccatga

DBGET integrated database retrieval system