KEGG   Acidovorax ebreus: Dtpsy_1181
Entry
Dtpsy_1181        CDS       T00853                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: Peripla_BP_4
Other DBs
NCBI-ProteinID: ACM32653
UniProt: B9MG62
Position
complement(1239489..1240103)
AA seq 204 aa
MTIGDGNLCAEDIPLRLASYGLMAPEDFIDEMRERMGMEDDAPTGRAVIPSTEPADGGEI
EMQVAVVCIGASGSPNVPVFKVRITQEEYDLGIHYDKARDLAEEARYEGPFICFDAAEYG
PILSAARELGLVPQVVVVDMTDGQIHSIRCDSGEIKVICYDTSDTDEYSAAVANRPLGEN
GQFVRCWSHTQLARVDPGLKLARD
NT seq 615 nt   +upstreamnt  +downstreamnt
gtgaccatcggggacggcaacctctgtgcagaggacattcccttgcgcctggcgagctat
ggcctgatggcccccgaggatttcatcgacgaaatgcgcgagcgcatgggcatggaagac
gacgcccccacgggccgagccgtcatcccctcgaccgaacctgccgacggcggtgagatc
gagatgcaagtcgcggtcgtctgcatcggtgcctccggtagccccaacgtgccggtcttc
aaggtcaggatcacccaggaggaatacgacctgggtatccactacgacaaggccagggac
ctggccgaagaggcccggtacgaagggccgttcatctgcttcgacgccgccgaatatggc
cccatcctgtcggccgcccgcgaacttggcctcgttccgcaggtcgtcgtggtcgatatg
accgacggccagatccactccatccgctgcgacagcggcgagatcaaggtcatctgctac
gacaccagcgacactgacgagtattcggcggcggtggcgaaccggccgctcggcgagaac
gggcagttcgtgcgctgctggtcgcacacccaactggcacgggtcgatcccggcctgaag
ctggctcgggattga

DBGET integrated database retrieval system