KEGG   Acidovorax ebreus: Dtpsy_1182
Entry
Dtpsy_1182        CDS       T00853                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dia  Acidovorax ebreus
SSDB
Other DBs
NCBI-ProteinID: ACM32654
UniProt: B9MG63
Position
complement(1240213..1240959)
AA seq 248 aa
MNHNAPASKVFYRPIEASLRWAGLLRFEHVILTSVSSSRNLPQSLDCPRWGELRLYTERI
YDGILNAELPFGRNGITTHDTALIDSPDLTVRHVDLKRWMRQHYPEQRPGFLFSRSERIA
HPSISLETGQAMLVERLALKSALEQSKRQLRELQDKHDALLKQSKIIPACAQYPISDRAE
ATYLNIIGGILELMLGQSPSGTPYSSFKTQEAVVSALVAHHHGVMGIAERTLNGKFATAR
RRLHSATL
NT seq 747 nt   +upstreamnt  +downstreamnt
atgaaccacaatgcaccagcatcgaaggtgttctatcgtccgatcgaagcctccctccgg
tgggctgggcttctgcggtttgagcatgtcatcctcacttcggtctcgtcgtcaaggaac
ctgccacagtcgttggattgcccacgttggggtgagctgaggctgtataccgaacgcatc
tacgatggcatcctcaatgcggaacttcctttcgggaggaacggcatcacgacgcacgac
accgcgctgatcgactcccctgatctcactgtccgtcacgtcgatctgaagcgttggatg
cgccagcactaccccgaacagcgccccggctttctcttctcgcgcagcgagcgcatcgcc
catccctccatctctctggaaaccgggcaggccatgctggtcgagcgcttggccctcaaa
tctgccctggagcagtccaagcgccaactccgcgagctgcaagacaagcacgacgcactg
ctcaaacagtccaaaatcatcccggcctgcgcgcagtacccaatcagtgatcgggccgaa
gccacctacctgaacatcatcggcggcatattggagctgatgctcggccaatcgccctcg
ggcacaccgtactccagcttcaaaacgcaagaggctgtcgtaagcgcattggtcgcccat
caccacggcgtcatggggatcgccgagcggacgttgaacggcaagttcgccacggccaga
cgccggctgcatagcgccaccctctga

DBGET integrated database retrieval system