KEGG   Acidovorax ebreus: Dtpsy_1185
Entry
Dtpsy_1185        CDS       T00853                                 

Definition
(GenBank) excinuclease ABC, C subunit
  KO
K03703  excinuclease ABC subunit C
Organism
dia  Acidovorax ebreus
Pathway
dia03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:dia00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    Dtpsy_1185
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dia03400]
    Dtpsy_1185
DNA repair and recombination proteins [BR:dia03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Dtpsy_1185
SSDB
Motif
Pfam: UvrC_HhH_N GIY-YIG HHH_5 UVR HHH HHH_2 Pox_polyA_pol_N APH
Other DBs
NCBI-ProteinID: ACM32656
UniProt: B9MG65
Position
1242927..1244900
AA seq 657 aa
MTTTYSDELLAQVAALPPLPGVYRYFDAQNVLLYVGKARNLKKRVSSYFSKQHGGTRIGH
MVGRIARLETTVVRSEAEALLLENNLIKSLGPKYNILFRDDKSYPYLKITGVSAKDGTGD
APGQCYPRMAYYRGAVDKRHRYFGPYPGAWAVKESIQLLQKVFRLRTCEDTVFANRTRPC
LLYQIKRCSAPCVGLISPTAYAADVRSAEAMLLGETQELLQTLEERMLAYAEKLEFEQAA
EVRNQITALARVLHQQAVETASDKDVDILAVKVAGGRACVNLAMVRGGRHLGDRPYFPVH
VEEATGVFQLETREDAPDNLMVEEAGGLEQSVPAQILAAFIAQHYLGVPLPPTLITSEPV
DPALLWVLAQQTGVRATVVHQPREQRRIWLEMAEQNAQIQLARLLAEEGSQRARTRALAE
ALDLEAESLDDLTIECFDISHTAGEATQASCVVFHHHKMQSGEYRRFKIEGITPGDDYAA
MRQVLMRRYSKVAEAQREAGGAEVTNAPRLPDLVLVDGGKGQVSMARDVFQELGLDISRI
VGVEKGEGRKVGLEELVFADGRDKVYLGRDSAALMLVAQIRDEAHRFAITGMRAARAKVR
VGGSRLEDIPGVGPKKRARLLQRFGGVRGVADASVDDLATVEGISHDLAEEIYRALR
NT seq 1974 nt   +upstreamnt  +downstreamnt
atgaccacaacctattcggatgagcttctggcacaggtggcggcgctgccacctttgccc
ggggtgtaccgctacttcgatgcacagaatgtcttgctatatgtcggcaaggcgcgcaac
ctgaaaaagcgggtcagcagctacttcagcaagcagcacggaggcacgcgcattggccat
atggtgggcagaattgcgcggctggaaacgacggtggtgcgctccgaggccgaggcgctc
ctgctggaaaacaatctcatcaagtccctgggcccgaagtacaacattctttttcgggac
gacaagagctacccttatctcaagatcaccggtgtctcggcaaaggacggtacgggggat
gctccggggcagtgctacccgcgcatggcgtattaccgcggggcagtggataaacgtcac
cgatacttcggtccttaccctggcgcatgggccgtcaaagaaagcattcagctactgcag
aaggtttttcggttgcgtacttgtgaagacacggtgtttgcgaatcgcacgcgtccctgc
ttgctgtaccagatcaaacgctgctccgctccgtgtgtgggtttgatttccccaacggcc
tatgccgcagatgtgcgcagtgcggaggcgatgctgctgggtgaaacccaggaactgctt
caaacgctggaagaacgcatgctcgcgtatgccgagaagctggagtttgaacaggcggcc
gaggtccgcaaccagatcacggcactcgcacgtgtgttgcaccaacaagcggtggagacg
gcatcggacaaggacgtggacatactcgccgttaaagtggctggcggccgtgcctgcgtc
aacctggcgatggtgcgcggtggccggcaccttggcgacaggccttactttccggttcac
gtagaggaagcgacaggtgtcttccaactggaaacgcgcgaggatgccccggataacttg
atggtagaggaggctggcggacttgagcagtcggtgccggcgcagatccttgctgcgttc
attgcgcagcactacctgggggtaccgttgccaccgacactgattacgagcgagccagtc
gaccccgcattgctttgggtgctggcacagcagacgggggtgcgagcgacagtcgtccac
cagccgcgtgaacaacggcgaatctggctggaaatggcggagcagaacgcacagatccag
ttggcacggttgctggcggaggagggttcccagcgggcgcgcacgcgtgccctggcggaa
gcgctggatctggaggcagagagcttggatgacctcaccatcgagtgtttcgacatttcg
cacactgcaggggaggcgacccaggcttcttgcgtggtttttcatcaccacaaaatgcaa
agtggcgagtaccgccgtttcaaaatcgagggcattaccccgggcgatgactatgcagct
atgcgtcaggtactcatgcgtcgctacagcaaggttgccgaagcacagcgtgaggcaggg
ggagcggaggtgacaaatgccccgcgcttgccggacctggtgctggtggacggtggcaag
gggcaagtaagcatggcgcgcgatgtgttccaggaactgggcctggatatctcacgcatc
gttggtgtcgaaaagggggagggccgcaaggtggggctggaagaactggtctttgcggat
ggacgcgacaaagtctatctggggcgagactcggctgcgctgatgctcgtggcgcagatc
cgtgacgaggcccaccgcttcgccatcaccggaatgcgcgccgctcgtgcaaaagtacgc
gtaggcggcagccgattggaagatatacccggtgtggggcctaaaaaacgggcaaggctg
cttcagcgctttgggggcgtgcgcggcgtggcagatgccagcgtggacgacctcgccacg
gtcgagggcatatctcacgacttggctgaagagatctatcgcgcgctgcgctga

DBGET integrated database retrieval system