KEGG   Acidovorax ebreus: Dtpsy_1186
Entry
Dtpsy_1186        CDS       T00853                                 

Definition
(GenBank) CDP-diacylglycerol/glycerol-3-phosphate 3-phosphatidyltransferase
  KO
K08744  cardiolipin synthase (CMP-forming) [EC:2.7.8.41]
Organism
dia  Acidovorax ebreus
Pathway
dia00564  Glycerophospholipid metabolism
dia01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dia00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dtpsy_1186
Enzymes [BR:dia01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.41  cardiolipin synthase (CMP-forming)
     Dtpsy_1186
SSDB
Motif
Pfam: CDP-OH_P_transf
Other DBs
NCBI-ProteinID: ACM32657
UniProt: B9MG66
Position
1244949..1245515
AA seq 188 aa
MFFTIPTIMTWTRIVAIPLIVGVFYAPLDPAMRNLIATVMFIVFAATDWLDGFLARKLNQ
TSAFGAFLDPVADKFLVCASLLVLVHMQRADVFVALIIIGREIAISALREWMAQIGASKS
VAVHMIGKLKTTVQMIAIPFLLYDGQLFGVIDTGVWGTWLIWVAAVLTVWSMVYYLQKAL
PEIRARVR
NT seq 567 nt   +upstreamnt  +downstreamnt
atgtttttcactattcccaccatcatgacttggacgcgcattgtcgcgatacccttgatc
gtgggagtgttctatgcgccgctggaccctgcgatgcgcaacctcatcgccacggtgatg
ttcatcgtttttgcggccaccgattggctcgatgggtttcttgcacgcaagctcaaccag
acctccgcgttcggggcgtttctggatcccgtggctgacaagttcttggtatgtgcgtcg
ctattggtactcgtgcatatgcaacgtgccgatgtgttcgtggcactcatcatcatcggc
cgcgaaatcgctatcagtgccttgcgggaatggatggcgcagatcggggcgagcaagagt
gtggccgtgcacatgatcggcaagctcaagaccacggtgcagatgattgccattcctttc
ctgttgtatgacgggcagttgtttggcgtcattgacacgggtgtgtggggtacctggctg
atctgggtcgccgcagtgctgacggtgtggtccatggtttattacctgcaaaaagcactg
ccagaaattcgtgcgagagtccgttaa

DBGET integrated database retrieval system