KEGG   Acidovorax ebreus: Dtpsy_1190
Entry
Dtpsy_1190        CDS       T00853                                 

Definition
(GenBank) transposase IS66
  KO
K07484  transposase
Organism
dia  Acidovorax ebreus
Brite
KEGG Orthology (KO) [BR:dia00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    Dtpsy_1190
SSDB
Motif
Pfam: DDE_Tnp_IS66 LZ_Tnp_IS66 zf-IS66
Other DBs
NCBI-ProteinID: ACM32661
UniProt: B9MG70
Position
complement(1249290..1250597)
AA seq 435 aa
MPMVVEPQSLDSLSPEQLRSALLSMLQAAAAKDQELAFKQTLIDKLTHENALLKRMKFAA
QSERFSPEQKSLLDDEIEADLAAVASEIDALAQTQAPATPEKRQAKRMPLPAHLPRREIR
HEPTSTTCACGCQMKRVGEDVAEKLDYVPGVFSVERHIRGKWACARCETIQQAPVEAHVI
DKGIPTTGLLAQVLVGKYADHLPLYRQEAIFGRAGLAIPRSTLAQWVGTCGVRLQPLVDA
LKTEILSHRVLHADETPVAMLKPGDGKTHRAYLWAYAPGAFESIKAVVYDFCESRSGEHQ
RAEVTRIRGEHSHHVCRAAVTEHVALVARIIKAVEELHAANCAERQYREAIEQAGYSSTH
LPSLAFLPRGVNYFDTSSPDGGYAPAWLRDAIEYTRTNQTTTDAAEQAGHVAARRTRDAA
VKALAKPADVGILAD
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgcccatggtcgtagagccgcaatccctggatagtctgagtcccgagcaattgcgctcg
gcgctgctgtccatgctgcaagccgctgctgccaaggaccaggagcttgccttcaagcag
accctcatcgacaagctcacgcacgagaacgcgctcttgaagcgcatgaagttcgccgcc
caatcagagcgcttcagccctgagcagaagagcctgctcgacgacgagatcgaagcggac
ctggcggccgtggccagcgagatcgacgcgctggcgcagacgcaagcaccggccaccccc
gagaagagacaggccaagcggatgcccttgccggcgcacctgccacgccgcgagatccgc
cacgaacccacgtccaccacgtgcgcgtgtggctgccagatgaaacgcgtgggcgaggac
gtggccgagaagctggactatgtgcccggcgtcttcagtgtcgagcgccacatccgcggc
aagtgggcctgcgcccggtgcgagaccattcaacaagcgccggtcgaggcgcacgtcatc
gacaaaggtatccccaccaccggcctgctggcccaggtgctggtgggcaagtacgccgat
cacctgccgctgtaccggcaggaggcgatcttcggccgcgctggcctggccatccctcgc
tcgaccctggcgcagtgggtgggcacctgcggggtgcggctgcagccgctggtcgatgcc
ctgaagaccgagatcctcagccaccgggtgctacacgccgatgagacgccggtggccatg
ctcaagcccggcgatggcaagacgcaccgcgcctacctctgggcctatgcgccgggggcc
ttcgagagcatcaaggctgtggtctacgacttctgcgaatcccgctcgggcgaacaccag
cgcgccgaggtgacgcgcatccgtggcgagcattcgcaccatgtctgccgtgccgcagtc
accgagcatgtggcattggtggcacgcatcatcaaggcagtcgaggaactgcacgccgcg
aactgtgccgagcggcaataccgcgaagccatcgagcaagcgggctacagcagcacgcac
ctgccttcgctggcattcctgccgcgtggcgtgaactactttgacaccagcagcccggac
ggaggatatgcgcccgcgtggctgcgcgatgccattgaatacacgcgcaccaatcaaacg
acaaccgacgcagccgagcaggccggccacgtcgccgcacgccgcacgcgtgatgctgcg
gtgaaggctttggcgaaacctgctgacgtgggcatcctggccgattga

DBGET integrated database retrieval system