KEGG   Acidovorax ebreus: Dtpsy_1191
Entry
Dtpsy_1191        CDS       T00853                                 

Definition
(GenBank) IS66 Orf2 family protein
  KO
K07484  transposase
Organism
dia  Acidovorax ebreus
Brite
KEGG Orthology (KO) [BR:dia00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    Dtpsy_1191
SSDB
Motif
Pfam: TnpB_IS66
Other DBs
NCBI-ProteinID: ACM32662
UniProt: B9MD25
Position
complement(1250672..1251004)
AA seq 110 aa
MIRIDALWLATEPLDMRAGTDTALARVVAVFGAARPHHAYLFANRRASRMKVLVHDGIGV
WLAARRLNSGKFVWPRDGALTTTLSRSQFDALVLGLPWQRLGDGGLITVL
NT seq 333 nt   +upstreamnt  +downstreamnt
gtgatccgcatcgacgccctgtggctggctaccgagccgctggacatgcgtgccggcaca
gacaccgcgctggcccgtgtggtggccgtcttcggtgctgcgcgtccgcatcacgcctac
ctgtttgccaaccggagagccagccgcatgaaggtgttggtgcacgacggcattggggtg
tggctggcggcgcggcgcctgaacagcggcaagttcgtctggccgcgtgacggtgcgttg
accaccacgctcagccgctcgcagttcgacgctctggtgctcgggttgccttggcagcgc
ctgggcgatggtggcctcatcaccgtgctctga

DBGET integrated database retrieval system