KEGG   Acidovorax ebreus: Dtpsy_1192
Entry
Dtpsy_1192        CDS       T00853                                 

Definition
(GenBank) transposase IS3/IS911 family protein
  KO
K07483  transposase
Organism
dia  Acidovorax ebreus
Brite
KEGG Orthology (KO) [BR:dia00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    Dtpsy_1192
SSDB
Motif
Pfam: HTH_Tnp_1 HTH_Tnp_ISL3 HTH_23 YdjO
Other DBs
NCBI-ProteinID: ACM32663
UniProt: B9MD24
Position
complement(1251001..1251339)
AA seq 112 aa
MTEAQNKTRRRHSAELKQQILAECAQPGASVASVALSHGINANVVHKWRRLAHAPSTDMQ
VPTFVPVTLPAPSCAPAPDIRIELRRGATSISLTWPVCAAEHCAAWMRDLLK
NT seq 339 nt   +upstreamnt  +downstreamnt
atgaccgaagcccagaacaagacccgtcggcgccacagcgccgagctcaagcagcagatc
ctggccgagtgcgcccagcccggtgcatcggtggccagcgtggcgctctcgcacggcatc
aacgccaacgtcgtgcacaaatggcgccgactggcccatgcccccagcacagatatgcaa
gttcccaccttcgtgccggtgacgctgcctgcgcccagctgtgcgccggccccagacatc
cgcatcgagttgcgccgtggcgctaccagcatctcgctgacctggccggtctgcgcggcc
gagcactgcgcggcctggatgcgggacctgctcaagtga

DBGET integrated database retrieval system