KEGG   Acidovorax ebreus: Dtpsy_1196
Entry
Dtpsy_1196        CDS       T00853                                 

Definition
(GenBank) hypothetical protein
Organism
dia  Acidovorax ebreus
SSDB
Other DBs
NCBI-ProteinID: ACM32665
UniProt: B9MGJ2
Position
1256345..1256764
AA seq 139 aa
MDGPLCLVYEETIEGLDGMERSRYWLLADGWTMGHAPCVENLAAVVHVAQQAGVLVVGKE
LRAPDLVRLQEGQAVVPELLQRTRGSWYPTDLVNPPPQHDSPWRQAMWHGGQGLLARPDT
VTASQAATPAAEPLDQAGQ
NT seq 420 nt   +upstreamnt  +downstreamnt
gtggatggtccactgtgtctggtctatgaggaaaccatcgaagggctggacggcatggag
cggtcgcgttactggctgttggccgatggatggaccatgggccatgccccctgtgtggaa
aacctggcggccgtggtgcatgtggcgcagcaggcgggtgtgctggtggtgggcaaggag
ttgagggcgcctgacctggtgcgcctgcaagaaggccaagcggtggtgccggaactgctg
cagcgcacgcggggcagttggtatcccaccgatctggtgaacccacctccccagcacgat
tcgccgtggcgtcaggctatgtggcatggtgggcagggtttgttggcgcggccagacacc
gtcactgcgtcccaggccgcaacgcctgcggcagagcctctcgatcaggctgggcagtag

DBGET integrated database retrieval system