KEGG   Acidovorax ebreus: Dtpsy_1198
Entry
Dtpsy_1198        CDS       T00853                                 

Definition
(GenBank) peptidase M14 carboxypeptidase A
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: Peptidase_M14 AstE_AspA DUF2817
Other DBs
NCBI-ProteinID: ACM32666
UniProt: B9MGJ3
Position
complement(1257646..1259466)
AA seq 606 aa
MTPKNLLSHTYALPIAAIAARHRATALLGAFLLSACSSTPLPPWPAQSSPPTPTGPQTSR
AVPPPLGTVQRGEVVPSPVTVTPVAPATEPASTALPYSAAVAARFPAPSVRYETPGLAEG
RQAFTTNAELTQWLRNLATAQRGTTRVQMLDLGVSQRGTPLHGLVLTRAAGTNVAALDAS
RRPTVLLLGQQHGDEPAGSEALLVLARELAQGLLEPMLERINVIVVPRANPDGAEAGTRA
TSNGIDMNRDHLLLQTPEAQALAKLVRNYRPIAIFDAHEYTVTGRFLEKFHAIQRYDVLL
QHATTANLPEFMTKAALEWFHHPMIRALEAEGLSQEWYYTTSTRAEDLRLSMGGTQPDTG
RNVNGLKNAVSMLVETRGVGIGRAHIQRRVHSQVTALTSALRSTVDRAADLEQVRSYEAR
DIASRACRGEIVVEATQTPGQRDLVMLDPQTGADRTLRVDWNSSLQLKPVKKRHRPCGYW
LASGATDAVERLKLLGIQVMHVAEAGSVLADIYEETSRESSEREDVRGAIPGARPIIRAT
VTPMRSAIDVPGGSYYVSLNQPLANLAVAALEPDTQNSYFANHVIGQLGDVARVMAPPSL
VFEEMD
NT seq 1821 nt   +upstreamnt  +downstreamnt
atgacgccgaagaatctgctctcccacacatacgcgctgccaatcgccgcaatcgcagca
cggcaccgcgctaccgcgctgctgggcgcattcctgctgtccgcctgctccagcacgccc
ctgcctccgtggcccgcgcagtcctccccccccacgcccactggtccgcaaacgtcccgc
gccgtaccgccgccgctgggaacagtgcagcgtggcgaagtcgtgcccagcccagtcacg
gtaacgcccgtcgccccggccaccgagccggcctccaccgcgctcccctacagcgcggct
gtcgcggcacgctttcccgcgccttccgtgcggtacgaaacgccggggctcgccgagggg
cgccaggctttcaccaccaacgctgaactcacccaatggctgcgtaatctggccacggcg
cagcgcggcacgacccgtgtgcaaatgctggacctgggggtatcgcagcgcggcacaccc
ttgcacggcctggtgctgacccgcgcggctggcaccaacgtggccgcgctggacgccagc
cgccgccccacggtgctgctgcttgggcagcaacatggcgacgaacccgccggcagcgag
gcattgctcgtactggcgcgcgaactggcacaagggctgctggagcccatgctggagcgc
atcaacgtgatcgtcgttccccgcgcgaatcccgacggagccgaggccggcacgcgggcc
acgtccaacggcatcgacatgaaccgggaccacctgcttttgcagactccggaggcccag
gcactcgccaaactggtgcgcaactatcgcccgatcgccattttcgatgcgcatgaatac
accgtcaccggacggttcctcgagaaattccatgccatccaacgctacgacgtgctgctg
cagcacgcaacgacggctaacctgccggaattcatgaccaaggcagctctggaatggttc
caccaccccatgatcagggccctggaagcggaaggcctgagccaggagtggtactacacc
acctcgacccgcgccgaagaccttcgcctgtccatgggagggacgcaacccgataccggc
cgcaacgtgaatggtctgaagaacgccgtcagcatgctcgtggaaacgcgcggcgtgggc
attggccgcgcccacatccagcggcgcgtgcactcgcaggtgacggccctcaccagtgca
ctgcgcagcaccgtggaccgcgccgccgacttggagcaggtgcgctcctatgaagcgcgg
gatattgcttcccgggcatgccgcggcgagatcgtggtggaagccacgcaaacccccggc
cagcgcgacctggtcatgctggacccacagaccggcgcagaccggaccctgcgcgtggat
tggaattcctcgctgcaactcaagcctgtcaaaaaacgccaccgcccctgcggctattgg
ttggcaagcggcgcaacggatgcagtggagcgcctgaagctgctgggcatccaggtgatg
cacgtcgccgaagcgggctccgtactggccgacatctatgaggaaaccagccgggagagc
tccgagcgagaggacgtgcgcggagccatccctggcgcccgcccgatcatccgcgccacc
gtgacccccatgcgcagcgccatcgacgtgccgggaggcagctattacgtgtctctcaac
cagcccttggccaatctggccgtggcagcgctggagcccgatacgcagaacagctatttc
gccaaccatgtcatcggccagctcggcgatgtggcacgggtcatggcacctccatcgctg
gtgtttgaggagatggactga

DBGET integrated database retrieval system