KEGG   Acidovorax ebreus: Dtpsy_1200
Entry
Dtpsy_1200        CDS       T00853                                 

Definition
(GenBank) ABC transporter related
  KO
K06020  energy-dependent translational throttle protein EttA
Organism
dia  Acidovorax ebreus
Brite
KEGG Orthology (KO) [BR:dia00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dia03016]
    Dtpsy_1200
Transfer RNA biogenesis [BR:dia03016]
 Prokaryotic type
  tRNA transport factors
   tRNA export factors
    Dtpsy_1200
SSDB
Motif
Pfam: ABC_tran AAA_21 ABC_tran_Xtn SMC_N MMR_HSR1 AAA_29 AAA_18 AAA_16 RsgA_GTPase AAA_23 DLIC AAA_33 AAA_14 AAA_22 NB-ARC HAUS4 DUF4815 DUF5798
Other DBs
NCBI-ProteinID: ACM32668
UniProt: B9MGJ5
Position
1261596..1263257
AA seq 553 aa
MAQYVFSMNHVTKTVPPKRQILKDISLSFFPGAKIGVLGLNGSGKSSLLKIMAGVDKEFE
GEALPMPGLSIGYLPQEPQLNPEHTVRQAVEEAMAEVNNAKARLEEVYAAYAEENADFDA
LAKEQGELEAIIAAAGTDSEHQLEIAADALRLPAWDAVIGKLSGGEKRRVALCKLLLSKP
DMLLLDEPTNHLDAESVDWLEQFLHRFSGTVVAITHDRYFLDNAAEWILELDRGHGIPYK
GNYSDWLIQKGNRLEAEQKGEEARAKALKKELEWVRQNAKGRQAKSKARIARFEELSDYE
YQRRNETQEIFIPVADRLGSKVIEFKNVSKAFGDRLLIDNLSMNIPAGAIVGIIGPNGAG
KSTLFKLIAGKEQPDSGTVEIGQTVKMAFVDQHRDALADDKTVWEDISGGLDIINVGKFQ
MASRAYAGRFNFNGQDQQKKVGNLSGGERGRLHLAKTLIQGGNVLLLDEPSNDLDVETLR
ALEDALLEYAGTVLVISHDRWFLDRIATHILAAEGDSQWVFFDGNYQEYEADKKKRLGEE
GAKPKRMRYKALK
NT seq 1662 nt   +upstreamnt  +downstreamnt
atggcccaatacgttttctcgatgaaccacgtcaccaagaccgtgccgcccaagcggcag
atcttgaaggacatttcccttagcttctttccgggcgccaagatcggcgtgctgggcctg
aacggctccggcaagtcctctctgctcaagatcatggcgggcgtggacaaggaattcgaa
ggcgaggcactgcccatgcccgggctgtcgatcggttacctgccccaggaaccccaactc
aatcccgagcacaccgtgcgccaggccgtggaagaagccatggccgaggtgaacaacgcc
aaagctcgcctggaagaggtatacgctgcttacgcggaagagaatgccgactttgacgcg
ctggccaaagaacagggtgaattggaggccatcatcgccgcggccggtaccgattccgaa
caccagttggaaattgcggccgacgcgctgcgtctgccggcgtgggatgcggtgatcggc
aagctatcgggtggcgaaaagcgtcgcgtggccctgtgcaagctgctgctgtccaagccc
gacatgctgctgctggacgaacccaccaaccacttggacgccgaatccgtggactggctg
gagcaattcctgcaccgcttcagcggtaccgtggtggcgatcacccacgaccgctacttc
ctggacaacgccgctgagtggattctggaactggaccgaggccacggcatcccctacaag
ggcaattattctgactggctgatccagaagggcaaccgtctggaagccgagcaaaaaggc
gaggaggctcgcgccaaggctttgaagaaggaactggagtgggtgcgccagaacgccaag
ggccgccaggccaagtccaaggcgcgtattgcccgcttcgaagagctgagcgattacgaa
taccagcgccgcaacgaaacgcaggaaatcttcattcctgtagcggatcgcctgggctct
aaggtcatcgaattcaagaatgtctccaaggcctttggtgaccgcctgctgatcgacaac
ctgagcatgaacatccctgccggcgccatcgtcggcatcatcggcccgaacggtgccggc
aagtcgaccctgttcaagctgatcgcgggcaaggagcaacctgattccggtaccgtggaa
atcggtcagaccgtgaagatggcctttgtcgatcagcaccgcgacgcactggccgatgac
aagaccgtgtgggaggacatctccggcgggctggacatcatcaacgtgggcaagttccaa
atggcgtcgcgcgcctatgccgggcgcttcaacttcaacggccaggaccagcagaagaag
gtgggcaacctgtccgggggcgagcgcggccgcctgcacctggccaagacgctgatccag
ggcggcaatgtgctgctgctggacgaaccgtccaacgacctggacgtggaaaccctgcgt
gcgctggaagacgcgttgctggagtacgctggcaccgtgctggtcatcagccacgatcgt
tggttcctcgaccgtatcgcgacccacatcctggcagccgagggcgacagccaatgggta
ttctttgacggcaattaccaagaatacgaagctgataagaaaaaacgattgggtgaagag
ggtgcgaaaccgaagcgtatgcgctacaaggccctcaaataa

DBGET integrated database retrieval system