KEGG   Acidovorax ebreus: Dtpsy_1201
Entry
Dtpsy_1201        CDS       T00853                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: DUF1631 Tox-GHH
Other DBs
NCBI-ProteinID: ACM32669
UniProt: B9MGJ6
Position
1263315..1265543
AA seq 742 aa
MSLSASRARTVFRACVVNAVRDSEALMEALVTGTREALTAQESSTRDLHKRTQISDALRL
LKQHEASLPKAYPMALLEIFAEGPSAAKTRAGQPGGMDLGELALMDDADVLVQVELSRAQ
QIAALATEATLAELNTLVSSAQGLHSVQPESNPFRPENYIRALQQVVSDTGVSGEVRQLW
MSQMRELLGMQLVSAYKRAAQSLREHGVEPVGYAVAGAPGVRSGHGGGYAHSSQMGVGYA
PPSAYGAPASEYGAASAYGQGYGAGWGGASGNVALAPQAEEALLTVGILRQMLAGGGDPF
AYDARGGYTAATPANAYVTPAAVEAMEDIAQLERIVGRLSGGAAVPVTGWNGTSAHAPVA
APPTRTAHEVVSRMMDNIAQDSRLLPPMQRAVQSLEPALKELVQHDTRFFTDEQHPARRL
LDELTQRSLAFNAEDGPAFSRFMRLVNEAVGHLASIEIRDAAPFAQVLKALEKAWTAQER
RQLERHEAQQRELLQREQRELLAEKIAADFRRLPDADKVPADLLAFVTGPWADVVAQAQS
SQPQETGGDPGGYLALVPLLLCCAQPEQLRSDPERLGQAIADMVPVLVRGLESIDHPIER
IAEVTQRLAQLQGEALNYAAASVFGDTPAEEVSPETRADDVLSSDTAAAADPSMAGAVAQ
PALRIGQWVEIITNQGAVRTQLTWCSPHNTLFLFTGADASTQSMTRRMIDKLSSDGAFRL
ISDQPVVDRALRAVRTKPAKLR
NT seq 2229 nt   +upstreamnt  +downstreamnt
atgtccctttccgcgtcccgcgcccgtacggtttttcgcgcctgcgttgtcaacgccgtc
agggacagcgaggcactgatggaggcgctggtgactggtacgcgcgaagcgctcacggcg
caggagtcctccacccgcgaccttcacaagcgtacccagatcagcgatgccttgcgcctg
ctcaagcagcacgaggcttcgttgcccaaggcctaccccatggccttgctggagattttt
gccgaaggcccctcggccgcgaagacgagggccgggcagcccggcggaatggacctgggc
gagctcgccctcatggacgatgccgacgtgctggtccaggtggagctgtcgcgggcacag
cagatcgccgctctggcgacagaggcaacgctggcggaactcaacacgctcgtcagttcg
gcgcagggcctgcacagcgtgcaacccgagagcaacccttttcgccctgagaactacatc
cgcgcgctgcagcaagtggtgagcgataccggtgtaagtggggaagtgcggcagctgtgg
atgagccagatgcgcgaactgctgggcatgcaactggtaagcgcctataagcgcgccgcc
cagagcctgcgcgagcatggcgtcgagcccgtgggctacgcggtggcgggagccccgggt
gtgcgcagcgggcatggtggtggatatgcccacagttcccagatgggcgtgggctacgcg
ccgccctcggcctatggtgcgccggccagcgaatatggtgccgcgagcgcctatggccaa
ggttacggggcaggctggggaggcgcctcgggcaacgtggccttggcgccgcaggccgaa
gaagcgctgctgacggtgggtatcctgcgccagatgctggccggtggtggtgaccctttc
gcctacgatgcacgcggcggctatacggcagctactccggccaacgcgtacgtcacgccg
gccgcggtggaagcaatggaagacattgcgcagctggaacgcatcgtgggtcgtctgtcg
ggaggggctgcggtcccggtgacgggctggaacggcacctctgcacatgcgccggtggcg
gcaccccccacgcggacggcgcatgaggtcgtgagccgcatgatggacaacattgcgcag
gattcgcggctgctgccccccatgcagcgtgccgtgcaaagcctggagcccgcgctgaag
gagttggtgcagcacgacacgcggttcttcacggatgagcagcaccccgcccggcgcctg
ctggacgagttgacccagcgcagcctggcattcaacgccgaggatgggcccgccttcagc
cgcttcatgcggctggtgaacgaagccgtaggccacctggcttccatcgagatccgggat
gccgcaccgttcgcccaagtgctcaaggcgctggaaaaggcctggaccgcgcaggagcgt
cgccagcttgaacgccatgaagcgcagcagcgcgaactgctccagcgggagcagcgggaa
ttgctggccgagaagattgccgccgacttccgccgcctgcccgatgcggacaaggtaccg
gccgacctgctggccttcgtgaccggcccgtgggcggatgtggtggcgcaggcgcaaagc
agccagccccaggaaaccggcggagatcccggaggctacctggcgttggtgccgctgctg
ctgtgctgcgcgcagcccgagcagttgcgctcggacccggagcgcctgggccaggccatt
gccgacatggtgccggtgttggtgcgtgggctggagagcattgaccacccgatcgagcgt
attgccgaagtgacgcagcgcttagcgcagcttcagggtgaagcgctgaactacgcagcg
gcgagcgtcttcggcgacacgccggcggaagaggtcagccctgaaacccgcgctgacgat
gtgctgtcttccgatacggccgccgcggcggacccgtcgatggccggagcagtggctcag
cccgcattgcgcatcggccagtgggtggaaatcatcaccaaccagggtgcggtacgaacc
cagctcacctggtgcagcccgcacaacacgctttttttgttcaccggagccgacgcgagc
acgcagtccatgacgcggcgcatgatcgacaaactgtcctccgacggggcattccgcctg
atttccgaccagccggtggtggaccgcgctttgcgcgccgtgcgcaccaagccggccaag
ctgcgctag

DBGET integrated database retrieval system