KEGG   Acidovorax ebreus: Dtpsy_1203
Entry
Dtpsy_1203        CDS       T00853                                 

Definition
(GenBank) peptidase S58 DmpA
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: Peptidase_S58
Other DBs
NCBI-ProteinID: ACM32671
UniProt: B9MGJ8
Position
complement(1266913..1267926)
AA seq 337 aa
MQACSLHSACGAITDVAGIEVGHFTDPRRPTGCSVVIAREGAVAGVDVRGAAPGTRETDL
LAPGNLVEQVHAIMLAGGSAWGLEAATGAVRWLEEHGVGLDVGVGRLPLVPAAVLFDLHV
GDMKVRPDAAAGYAACAAATREPPAEGNVGAGAGAVVGKMFGLQHAMKGGVGTASVTVAG
VTVGALIACNAVGDVVDPDTGRPLAGARAADGLTLRDTRHALLLGEPPHPLLAGSNTTIG
VIATDARLTKVQAQRLAVAGHDGLARSINPVHTMSDGDTLFTLSTGHVPHHPGMMVLATM
AGEAVARATVRAVLAARTLRTAEGLALPCHADLSAGS
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgcaagcttgctccctgcacagcgcctgcggcgccatcaccgacgttgccggcatcgag
gtcggccacttcaccgacccacgccgccccaccggctgcagcgtggtgattgcgcgcgag
ggtgccgtggcaggcgtggatgtgcgcggcgccgcccccggcacgcgcgagaccgacctg
ctggccccgggcaacctggtggagcaggtgcacgccatcatgctggcgggtggcagcgcc
tgggggctggaggccgccacgggggccgtgcgctggctggaggagcacggcgtagggctg
gacgtgggcgtgggccgcctgccactggtgccagcggccgtgctgttcgacctgcacgtg
ggcgacatgaaggtgcgtcccgatgcggcggccggctatgcggcctgcgctgccgccaca
cgcgagccgccagccgagggcaacgtaggcgccggcgctggcgccgtggtgggcaagatg
ttcggcctgcagcacgccatgaagggcggcgtgggcacagcctcggtcaccgtcgcgggc
gtcacggtgggtgcgctcattgcctgcaacgccgtgggcgacgtggtcgacccggacacc
gggcgcccactggcgggcgcccgcgctgccgacgggctgacgctgcgcgatacacggcac
gcgctgctgctcggcgagccccctcatcccctgctggccggcagcaacaccacgatcggc
gtgatcgctaccgacgcgcggctgaccaaggttcaagctcagcgactggccgttgccggc
catgacggcctggcccgcagcatcaaccccgtgcacaccatgagcgacggagacacgctg
ttcacgctgtcgaccggccacgtgccgcaccaccccggcatgatggtgttggccacgatg
gcgggcgaggcggtggcccgcgccaccgtgcgcgccgtgctcgccgcgcgcaccctgcgc
acggccgagggcctggcacttccgtgccatgccgatctgtctgccgggagctag

DBGET integrated database retrieval system