KEGG   Acidovorax ebreus: Dtpsy_1206
Entry
Dtpsy_1206        CDS       T00853                                 

Definition
(GenBank) protein of unknown function DUF411
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: DUF411
Other DBs
NCBI-ProteinID: ACM32673
UniProt: B9MGK0
Position
complement(1269765..1270259)
AA seq 164 aa
MRITQPTRRQWMTALAAGLAGAALPALARAAAPQTAVEVWKDPNCGCCKDWVTHMQANGF
TVTVHETGNAAVRAKLGLPTRLGSCHTALVGGYLLEGHVPAADVRKLLKDKPKALGLTVP
GMPVGSPGMDGPEYNGRKDPYDVLLVTKNLVNSDVSTRVFTSYR
NT seq 495 nt   +upstreamnt  +downstreamnt
atgcgaatcacgcaacccacccgccgccaatggatgacggccctcgccgccggcttggcc
ggcgctgccctgcccgccctggcccgtgccgccgccccgcagactgccgtggaggtctgg
aaagaccccaactgcggctgctgcaaggattgggtgacccacatgcaggccaacggcttc
acggtcaccgtgcacgaaacgggcaacgccgccgtacgcgccaagctcggcctgcccacg
cgcctgggctcatgccacaccgcgctggtgggtggttatctgctcgaaggccatgtgccc
gctgccgatgtgcgcaagctgctcaaggacaaacccaaggccctgggcctcaccgtcccg
ggcatgccggtgggcagccccggcatggacgggcccgagtacaacggccgcaaggacccg
tacgacgtgctgctggtcaccaagaacctggtgaacagcgacgtctccacgcgcgtattc
accagctaccgttga

DBGET integrated database retrieval system