KEGG   Acidovorax ebreus: Dtpsy_1207
Entry
Dtpsy_1207        CDS       T00853                                 

Definition
(GenBank) blue (type 1) copper domain protein
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: Copper-bind Cupredoxin_1 Cu-oxidase_2 CzcE
Other DBs
NCBI-ProteinID: ACM32674
UniProt: B9MGK1
Position
complement(1270294..1270776)
AA seq 160 aa
MKSIKFIAACALLAGATASFSHENMHNSHPAVAPQQQEWGIAGEAKGAKRTITLHMTDDM
RFTPSHFTVKQGETVRLRVENQGQVMHEVVLGTQGTLDQHAAMMRQYPDMEHAEPHMAHV
APRAKEDLVWHFNRPGRFDFACLIPGHYEAGMRGTFTVTP
NT seq 483 nt   +upstreamnt  +downstreamnt
atgaaatctatcaaattcatagctgcttgcgctttactggcgggcgctacagccagtttt
agccatgagaacatgcacaacagccaccctgccgtcgccccgcagcagcaggaatggggg
attgcgggagaggccaagggcgcaaagcgcaccatcaccttgcacatgacggacgacatg
cgctttaccccgtcgcacttcaccgtcaaacagggcgagaccgtgcgcctgcgcgtggag
aaccagggccaggtcatgcatgaggtggtgctgggcacacagggcacgttggaccagcat
gcggccatgatgcgccagtaccccgacatggagcacgccgaaccccacatggcacacgtg
gccccgcgcgccaaggaagatctggtctggcacttcaaccggcccggccgcttcgacttc
gcctgcctgatccccggccactacgaagcaggcatgcgcggcaccttcaccgtcacgccc
tga

DBGET integrated database retrieval system