KEGG   Acidovorax ebreus: Dtpsy_1209
Entry
Dtpsy_1209        CDS       T00853                                 

Definition
(GenBank) copper tolerance protein
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: OEP LPAM_1
Other DBs
NCBI-ProteinID: ACM32676
UniProt: B9MGK3
Position
complement(1272183..1273616)
AA seq 477 aa
MRRPPLALAALAAALVLAGCASVAPDGLRGDVQSHVQPRLPDGAQLPAPDAQSRSDAQAQ
ITEWLRLPVDADTAVRVALLNSPALQARLANLAAQDAQRAQALTLFNPTLTLGRFTSGHE
REIERQLGFSLVNVITLPWRTRWQGWQMEQATLAAAQDVLRLAADTRRAWLRAVAARQVL
AARERMHEAAEAGGELARRMARVGNFSRLQQAREIAITQDAAAQLARARLHAALEREQLA
RLMGLWGAQADFTLPDALPALPAADALRSGDDAEATALRERLDLRALRRDLDTTADRSGW
AGVGSVFGDIGLSYSRNTATERASGHRETTRGWEVELPLPLFDWGGAATGRARAELQHSA
AQLQDAAIRARSEARSHWLRYRTAWDLAHQQQAEALPLARFMQDEAVLRYNGMFISVWEL
LAEARRASQAVAAATEAQRDFWLAQTDLQLALTGTSPGAPTGLPSAPTTPNAPSEGH
NT seq 1434 nt   +upstreamnt  +downstreamnt
atgaggcgccctccgctcgccctggctgcgctggccgctgcactggtgttggccggctgc
gccagcgtcgcccccgatgggctgcgcggcgacgtgcaaagccatgtccagccccgcctg
cccgacggcgcgcaactgcccgcgcccgatgcgcaaagccgcagcgacgcgcaggcccag
atcaccgaatggctgcgccttcccgtggatgcggacaccgccgtgcgcgtggcgctcttg
aacagccccgcgctgcaggcccgcctggccaatctggccgcgcaggatgcgcagcgtgca
caggcgctgaccttgttcaaccccacgctgacgctggggcgattcaccagcgggcatgag
cgcgagatcgagcgccagctcggcttcagcctggtcaacgtgatcaccctgccctggcgc
acgcgctggcaaggctggcagatggagcaggccacgctggccgctgcacaggatgtgctg
cgcctggccgcggacacacgccgcgcctggctgcgcgccgtggccgcccggcaggtgctg
gccgcgcgcgaacgcatgcacgaggcggccgaggccggcggcgagctggcgcggcgcatg
gcgcgcgtgggcaacttcagccggctgcagcaggcacgcgaaatcgccatcacacaggac
gcggcagcacagctggcccgcgcgcggctgcatgccgcgctggagcgcgagcaactggcg
cggctgatggggctgtggggtgcgcaggccgacttcacgctgccggatgcgctacccgcc
ttgcccgcggcggatgcactgcgcagcggcgacgacgccgaagccacggccctgcgcgag
cggctggacctgcgcgcgctgcgccgcgacctggacaccaccgccgaccgcagcggctgg
gccggtgttggatccgtgttcggcgacatcggcctgagctacagccgcaacactgcgacc
gagcgcgcctccggccaccgcgagaccacacgcggctgggaggtagagctgcctctgccg
ctgttcgactggggcggagctgccacgggccgcgcgcgggccgagttgcagcacagcgcc
gcgcaactgcaggatgccgccatccgcgcgcgcagcgaggcacgcagccactggctgcgc
taccgcaccgcctgggacctggcgcaccagcagcaggccgaggctttgccgctggcgcgc
ttcatgcaggacgaggccgtgctgcgctacaacggcatgttcatcagcgtgtgggagctg
ctggccgaggcgcgccgcgccagccaggccgtggctgccgccaccgaggcgcagcgcgac
ttctggctcgcccagaccgacctgcaactggctctcacgggcacatcgcccggcgcgccc
accggcctgccgtccgctcccaccacccccaacgccccttcggaaggccactga

DBGET integrated database retrieval system