KEGG   Acidovorax ebreus: Dtpsy_1210
Entry
Dtpsy_1210        CDS       T00853                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dia  Acidovorax ebreus
SSDB
Other DBs
NCBI-ProteinID: ACM32677
UniProt: B9MGK4
Position
complement(1273613..1273960)
AA seq 115 aa
MRFAHPTSPAAMMALAALAGIAPPTWAQVDNVPAAPSQTATADSAQAPSLPLHHQPLPPS
GDVAEADIGWKAANTAVGAFPGGHSDIVRWEAEQARAAPPSPGMPTPKHHYGGRP
NT seq 348 nt   +upstreamnt  +downstreamnt
atgcgcttcgcgcaccccaccagccctgcggccatgatggccctggcggccctggccggc
atcgcaccgccgacctgggcgcaggttgacaatgttcctgccgccccatcgcagaccgcc
accgccgactcggcacaggcccccagtctgcccttgcaccaccagcccctgccccccagc
ggcgatgtggccgaggccgacatcggctggaaggccgccaacaccgccgtgggcgccttt
cccggtggccactccgacatcgtgcgttgggaagccgagcaggcacgcgccgcgccgccc
agccctggcatgcccaccccgaaacaccactacggaggccggccatga

DBGET integrated database retrieval system