KEGG   Acidovorax ebreus: Dtpsy_1212
Entry
Dtpsy_1212        CDS       T00853                                 

Definition
(GenBank) protein of unknown function DUF161
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: YitT_membrane
Other DBs
NCBI-ProteinID: ACM32679
UniProt: B9MGK6
Position
complement(1274541..1275167)
AA seq 208 aa
MSTTTANAAPAMVPHTRTEDAVAIGVGVTLISVGVAFLASAGLLTGGMAGLAFVLHYATG
IGFGKLFFALNLPFYWLALRKLGLAFTLKTFAAVALLSVLSELQSQFLQISELQPLYAAI
TGGLIMGMGFLVLFRHRCSLGGVGIMALYLQDRFGWRAGKVQMAVDCCIVLAALVTVEPL
RVLWSVIGAVALNLVLAMNHRPGRYMAV
NT seq 627 nt   +upstreamnt  +downstreamnt
atgtccaccaccaccgccaacgccgctcccgccatggtcccgcacacccgcaccgaagac
gccgtggcgattggcgtcggcgtgacgctgatctccgtgggcgtggccttcctcgccagc
gccgggctgctcaccggcggcatggcggggctggccttcgtgctgcactacgccacgggc
atcggcttcggcaagctgttcttcgcgctcaacctgccgttctactggctggcgctgcgc
aagctgggcctggccttcacgctcaagaccttcgcggccgtggcgctgctgtcggtgctg
tcggagctgcagtcgcagttcctgcagatcagcgaactgcagccgctgtatgcggccatc
accggcgggctgatcatgggtatgggctttttggtgctgttccgccaccgctgcagcctg
gggggcgtgggcatcatggcgctgtacctgcaggaccgcttcggctggcgcgccggcaag
gtgcagatggccgtggactgctgcatcgtgctggcggcgctggtcacagtggagccgctg
cgcgtgctgtggtcggtcatcggcgccgtggcgctcaacctggtgctggccatgaaccac
cggccagggcgctacatggcggtctga

DBGET integrated database retrieval system