KEGG   Acidovorax ebreus: Dtpsy_1213
Entry
Dtpsy_1213        CDS       T00853                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: DUF3703
Other DBs
NCBI-ProteinID: ACM32680
UniProt: B9MGK7
Position
complement(1275315..1275734)
AA seq 139 aa
MTMTQSPQSRQRAAYDYLLQRWRTSVDAPTEQRWRYLEAAHVVGQNRLGLHWRAHWQMLR
FARQLGDAPEARGQWARLGLTLVGHLVRRLPQGNIGRASVPALRPMVPSVAVRACITEAM
QATQPPGTPGAQEMSPIDL
NT seq 420 nt   +upstreamnt  +downstreamnt
atgaccatgacccaatcaccacaaagccgccagcgcgccgcctacgactacctgctgcag
cgctggcgcaccagcgtggatgcgcccaccgaacagcgttggcgctacctggaggccgcc
catgtggtgggccagaaccgcctgggcctgcactggcgcgcgcactggcagatgctgcgc
tttgcgcgccagttgggcgacgcgccggaggctcggggccaatgggcgcggctgggcctc
acgctggtgggccacctggtgcgccggctgccgcagggcaacatcggccgtgccagcgtg
cccgcgctgcggcccatggtgcccagcgtggccgtgcgcgcatgcatcaccgaagccatg
caggccacccagccccccggcacgccgggtgcgcaagagatgagtccaatcgacctctag

DBGET integrated database retrieval system