KEGG   Acidovorax ebreus: Dtpsy_1214
Entry
Dtpsy_1214        CDS       T00853                                 

Definition
(GenBank) heavy metal translocating P-type ATPase
  KO
K01534  Zn2+/Cd2+-exporting ATPase [EC:7.2.2.12 7.2.2.21]
Organism
dia  Acidovorax ebreus
Brite
KEGG Orthology (KO) [BR:dia00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Dtpsy_1214
Enzymes [BR:dia01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.12  P-type Zn2+ transporter
     Dtpsy_1214
    7.2.2.21  Cd2+-exporting ATPase
     Dtpsy_1214
SSDB
Motif
Pfam: E1-E2_ATPase Hydrolase HAD Hydrolase_3
Other DBs
NCBI-ProteinID: ACM32681
UniProt: B9MGK8
Position
complement(1275731..1277752)
AA seq 673 aa
MSQSHSSHSASHSHGPGAANLPPPPASACSGCACSTSAGDGHDHGTLPGWPRIAAALALA
TGAEAAHWMQQDYAGMALAVVAIALSGLGVYRVGLKDLARLRLGIHALMAVAVTGALLIG
QWPEAAMVMALYVAAERIEDGAMDRARHAIRQLLQLAPATADVQQPNGSTLSLPVDQVPL
RATVRIAPGAHVPLDGTVTHGSSSVNQAPITGESQLADKAAGDPLYAGSVNQQGELLMQV
NTPPGDTLIARIVRAVEQAQASKAPIQRFVDRFAAIYTPVVFALAVLLALLAPPLMGWTW
TQSTYQALALLVIACPCALVISTPVTVVSALTAAARRGILIKGGSALEAARGLRVVALDK
TGTLTIGSPALVQWRALNGADADAVADVAWQLASRSEHPVSRAIAAGLPAATHNGVQNLQ
ALPGRGVQAEVGGQRWWLGNLRLMREQGLADAALEDALAQQERQGRTVTLLADAQAVRAL
FAVADPLRGHARQAIAELRALGVHPVVLSGDNPATAQAIAAEAGITDAQDALGGLLPQDK
LDTLAALQRTRGPTAMAGDGINDAPALAQADVGFAMGGAHSTGMAMETADVVLMNDDLRR
IPDTVRLARRAHAVLWQNITLALGIKAAFFTLALLGMASMWMAVAADMGVSLLVVANGLR
LRRGASIAAKEAA
NT seq 2022 nt   +upstreamnt  +downstreamnt
atgagccaaagccattcctcccattccgcgtcccattcccatggcccgggcgcggcaaac
ctgcctcctccgcccgcatccgcatgcagcggctgcgcctgcagcacatcggcgggcgac
ggccacgaccacggcaccctgcccggttggccgcgcatcgccgcggcgctggccctggcc
acgggcgccgaggcggcgcactggatgcagcaggactacgccggcatggccctggccgtg
gtggcgattgcactgtcgggcctgggcgtgtaccgggtgggcctcaaagaccttgcgcgc
ctgcgcctgggcatccacgcgctcatggccgtggcggtgacgggcgccttactcatcggc
cagtggcccgaggcagcgatggtcatggcgctgtacgtggcggccgagcgcatcgaggac
ggcgccatggaccgcgcgcgccatgccatacgccagctgctgcaactggcgcccgccacg
gccgacgtgcagcagccgaatggcagcaccctgagcctgcccgtggaccaggtgccgctg
cgtgccaccgtgcgcattgccccgggcgcgcatgtgccgctggacggcaccgtcacccac
ggcagcagcagcgtgaaccaggcccccatcaccggcgagagccaactggccgacaaggcc
gccggcgacccgctgtacgcgggcagcgtgaaccagcagggcgagctgctgatgcaggtg
aacaccccgcccggcgacacgctgattgcgcgcatcgtgcgcgcggtggagcaggcgcag
gccagcaaggcccccatccagcgcttcgtggaccgctttgccgccatctacacgcccgtc
gtgttcgcactggccgtgctgctggcgctgctggcccccccgctgatgggctggacctgg
acgcagtccacctaccaggcgctggcgctgctggtcatcgcctgcccctgcgcgctggtc
atctccacgccggtcacggtggtcagcgcgctcacggccgccgcgcggcgcggcatcctc
atcaagggcggcagcgcgctggaggccgcgcgcggcctgcgcgtggtggcgctggacaag
accggcacgctgaccatcggcagccctgccctggtgcagtggcgtgccctgaacggcgcc
gatgccgacgccgtggcagatgtggcctggcagctggccagccggtctgagcacccggtc
tcgcgcgccatcgccgccggcctgcccgcggccacccacaacggcgtgcagaacctgcag
gccctgcccggtcgcggcgtgcaggccgaggtgggcggccagcgctggtggctgggcaac
ctgcgcctgatgcgcgaacaaggcctggccgacgctgcgctcgaagacgccctggcccaa
caggagcggcagggccgcaccgtcaccttgctggccgacgcgcaagccgtgcgcgcgctg
ttcgccgtggccgacccgctgcgcggccacgcgcgccaggccatcgccgaactgcgcgcg
ctgggcgtgcacccggtggtgttgagcggcgacaacccggccaccgcacaggccatcgcg
gccgaggcgggcattaccgacgcgcaggacgcgctcggcggcctgctgccgcaggacaag
ctcgacaccctggccgcgctgcagcgcacgcgcggccccaccgccatggcgggcgacggc
atcaacgatgcgcccgcgctggcccaggccgacgtgggcttcgccatgggcggcgcacac
agcaccggcatggccatggagacggccgacgtagtactcatgaacgacgacctgcgccgc
attcccgacaccgtgcggctggcacgccgcgcacacgccgtgctgtggcagaacatcacc
ctggcgctgggcatcaaggccgcgttcttcaccctggcgctgctgggcatggccagcatg
tggatggccgtggcagccgacatgggcgtgagcctgctggtggtggccaacgggctgcgc
ctgcgccgcggtgcctctatcgcggcgaaggaggccgcatga

DBGET integrated database retrieval system