KEGG   Acidovorax ebreus: Dtpsy_1217
Entry
Dtpsy_1217        CDS       T00853                                 

Definition
(GenBank) Mammalian cell entry related domain protein
  KO
K02067  phospholipid/cholesterol/gamma-HCH transport system substrate-binding protein
Organism
dia  Acidovorax ebreus
Pathway
dia02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:dia00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Dtpsy_1217
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dia02000]
    Dtpsy_1217
Transporters [BR:dia02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   gamma-Hexachlorocyclohexane transporter
    Dtpsy_1217
   Phospholipid transporter
    Dtpsy_1217
   Mce system transporter
    Dtpsy_1217
SSDB
Motif
Pfam: MlaD DUF948 Laminin_I
Other DBs
NCBI-ProteinID: ACM32684
UniProt: B9MGL1
Position
1279186..1280196
AA seq 336 aa
MTDPQRPQPPLSEPPANAPVELLRPVAHLERKAAALLLFTLVLVLGAGLYLLYARGAFEP
TQRLVLTAEDSEGVVVGMDMTFSGFPIGRVRRIELAETGNVRILIDVAQRDAHWLRTSSV
FTLVSGLVGGTTIKAYSGMLADPPLEDGAERPVLRGDATAEIPQLMSSARQLLDNLNAMT
GAESALGGAMAQVRTLTERLNAPGGALGVLMGNETDAKKILTTLERTNQLLARIDGMAAK
ADRQVFGAGGDPGLVPEVRAAVVQLNGLLADARQSLTKVDAVLAEAQAVGANAREATTDL
GALRAEVEGSLRKVDALVNEINRKWPFARETELKLP
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgaccgatccgcaacgtccccaacccccgctgtccgaaccgcccgcgaacgcgccggtc
gagttgctgcggcccgtggcccatctggagcgcaaggccgcggcgctgctgctgttcacg
ctggtgctcgtgctgggtgccggcctgtacctgctgtacgcgcgcggcgcgttcgagccc
acgcagcggctggtgctcacggccgaagattccgagggcgtggtcgtgggtatggacatg
acgttctcgggctttcccatcggccgagtgcggcgcatcgaactggccgagaccggcaac
gtgcgcatcctcatcgacgtggcccagcgcgacgcgcactggctgcgcacctccagcgtg
ttcaccctggtcagcgggctggtgggcggcaccaccatcaaggcctacagcggcatgctg
gccgacccgccgctggaggacggcgccgagcgccccgttctgcgcggcgacgccacggcg
gagattccgcagctcatgtcatcggcacgccagctgctggacaacctgaacgccatgacc
ggcgcagagtccgccctgggcggcgccatggcccaggtgcgcacgctcaccgagcggctc
aacgcgcctggcggcgccctgggcgtgctcatgggcaacgagacggacgcgaagaagatc
ctcaccacgctggagcgcaccaaccagttgctcgcgcgcatcgacggcatggccgccaag
gcggacaggcaggtcttcggtgcggggggcgaccccgggctggtgcccgaggtgcgggcc
gccgtggtgcagctcaacggtttgctggccgacgcgcgccagagcctcaccaaggtggac
gccgtgctggccgaggcccaggccgtgggcgccaacgcgcgcgaggccacgaccgacctg
ggcgcattgcgcgccgaggtggaaggcagcctgcgcaaggtggatgccttggtgaacgag
atcaaccgcaagtggccctttgcccgcgaaacggagctgaaactgccatga

DBGET integrated database retrieval system