KEGG   Acidovorax ebreus: Dtpsy_1219
Entry
Dtpsy_1219        CDS       T00853                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: PGG DUF4148
Other DBs
NCBI-ProteinID: ACM32686
UniProt: B9MGL3
Position
complement(1280941..1281114)
AA seq 57 aa
MKRHFRPGSRAYAAFVVTVVLAFAASVMTLVPHQTTQVADSQVHSQLEQLVPAGVFD
NT seq 174 nt   +upstreamnt  +downstreamnt
atgaaacgccatttccgccccggatcgcgcgcctacgcggcctttgtggtcaccgtggtc
ctggccttcgcggccagcgtcatgaccctggtgccccaccagacgacccaggtggccgac
tcgcaggtgcacagccagctggagcaactcgttcccgctggcgtcttcgactga

DBGET integrated database retrieval system