KEGG   Acidovorax ebreus: Dtpsy_1221
Entry
Dtpsy_1221        CDS       T00853                                 

Definition
(GenBank) D-amino-acid dehydrogenase
  KO
K00285  D-amino-acid dehydrogenase [EC:1.4.5.1]
Organism
dia  Acidovorax ebreus
Pathway
dia00360  Phenylalanine metabolism
dia01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dia00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Dtpsy_1221
Enzymes [BR:dia01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.5  With a quinone or other compound as acceptor
    1.4.5.1  D-amino acid dehydrogenase (quinone)
     Dtpsy_1221
SSDB
Motif
Pfam: DAO Pyr_redox_2 NAD_binding_8 FAD_binding_3 Pyr_redox FAD_binding_2 TrkA_N Amino_oxidase ApbA UDPG_MGDP_dh_N 3HCDH_N Thi4 NAD_binding_7 HI0933_like GIDA Sacchrp_dh_NADP XdhC_C F420_oxidored RHS_repeat DUF2124 Pyr_redox_3
Other DBs
NCBI-ProteinID: ACM32688
UniProt: B9MGL5
Position
complement(1282851..1284098)
AA seq 415 aa
MHIIIVGAGIVGAATAYELAADGHQVTVVEQRGAAAEEASFGSSGLLAPSLLMPWAAPGL
GGPLGRWPWSRDATLRLVRGAGMAGRRWRWRWSQAGRRPETAARLAGLEGLGRYSLARTR
ELIHQWDVGLETSRGTLVLLRRPEDVERLQPALKVLRDAGVGLRDVDADTARLIEPGLST
DVPLAGAVHVPDGESGNCRLFAQILRHTAQERGAQFVFGAHVRALSASPPGVHVVGEAAP
RQADAVVLCAGVASAALLRPLGRHLPLEAVHGYTVSAPVREDSHAPQGSVIDPLHRITIT
RQGQRVRVSGGAEIGHGNGSHHAPTLQTLYLALSGWFPGGALTSSPQVQVWRGARPTLTD
GAPAIGASGVSGLWINTGHGACGWAQACGSARALADLIARRSPAIDLQPFAPQRF
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgcacatcatcatcgtgggcgccggcatcgtcggcgcggccactgcttatgaactggcc
gcggacggccatcaggtcaccgtggtcgagcagcgcggcgccgcggcagaggaggcgagc
ttcggcagctccggcctgctggcgccctcgctactcatgccgtgggcggcgccgggcctg
ggtgggccgctcggccgctggccttggagccgcgatgccacgctgcgcctggtacgcggc
gccggcatggcaggccggcgctggcgctggcgctggtcccaggcgggtcgccggcccgag
acggcggcgcggctggccgggctggaagggctgggccgctacagcctggcacgcacgcgc
gaactgatccaccaatgggacgtgggcctggaaaccagccgcggcactctggtgctgctg
cgccgccccgaagatgtggagcgcctgcagcccgcgttgaaggtgctgcgcgacgcgggc
gtgggtctgcgcgatgtggatgccgacaccgcgcggctcatcgagcccggcctgtccacc
gacgtgccgctggcgggtgccgtgcatgtaccggatggcgagtccggcaactgccggctg
tttgcgcagatcctgcgccacacggcgcaggagcgcggcgcacagttcgtgttcggcgcg
catgtccgcgctctcagcgcatcgccgcccggcgtccacgtcgtaggcgaagccgccccg
cgtcaggccgacgccgtggtgctgtgcgccggcgtggccagcgccgcgctgctgcgcccg
ctgggacgccacctgcccctggaggccgtacatggctacaccgtcagcgcgccggtgcgc
gaggacagccatgcaccccagggctcggtgatcgatccgctgcaccgcatcaccatcacc
cgccagggtcagcgcgtacgtgtgtccggcggcgccgagatcgggcacggcaacggcagc
caccacgcgcccacgctgcagacgctctacctcgcgctgtcaggctggttcccgggcggc
gcgctcacctcgtccccgcaagtgcaggtctggcgcggcgcgcgccccacgctgaccgat
ggcgcccccgccatcggcgcgagcggtgtgtccggcctgtggatcaacaccggccacggc
gcttgcggctgggcccaggcctgtggcagtgcccgcgccctggcggacctgatcgcccgg
cgcagtcccgcgattgacctgcagccctttgcgcctcagcgcttctag

DBGET integrated database retrieval system