KEGG   Acidovorax ebreus: Dtpsy_1222
Entry
Dtpsy_1222        CDS       T00853                                 

Definition
(GenBank) Amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
dia  Acidovorax ebreus
Pathway
dia00970  Aminoacyl-tRNA biosynthesis
dia01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dia00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Dtpsy_1222
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dia03029]
    Dtpsy_1222
Enzymes [BR:dia01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Dtpsy_1222
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Dtpsy_1222
Mitochondrial biogenesis [BR:dia03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Dtpsy_1222
SSDB
Motif
Pfam: Amidase
Other DBs
NCBI-ProteinID: ACM32689
UniProt: B9MGL6
Position
complement(1284150..1285496)
AA seq 448 aa
MLADLVSTRSHVAAGHSSARDEIERCIAAAEGPTCAHVFRQTSFDQARAAAAVPGVERLP
LAGLAVSVKDLFDIQGMTTAAGSTVLREAPPAPADSPAVARLRRAGAAFIGRTHMVEFAF
SGVGVNPHFGTPAAFDARHGALPGPARVCGGSSSGAGVSVATGAAFIGLGSDTGGSIRIP
AALNGIVGFKNTARLVPTEGAVPLSTTLDTACALTRTVRDAVVAHEILAARRVTRSPAPL
SAWRLAVPATLFLDGLDATVARAFDRTLSRLRAAGAQITEIDLAETAQLADVNATGGFSA
AESYAWHRALLARHGNAYDPRVKSRIERGASMSAADYIDLLHARRAWIARMQTAMADFDA
LLSPTVPIVAPPIASVAPGSERDAEFFRVNGLLLRNTSVVNMLDGCALSLPCHEAGELPV
GLMVWHGALRDDPVLNIGLLIEQELQKQ
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgttggctgacctcgtctccacccgcagccacgtagctgccgggcatagcagcgcacgc
gatgaaatcgagcgctgcatcgccgccgccgaagggcccacctgcgcccatgtgttccgc
cagaccagcttcgaccaggcccgcgcagcagccgccgtgcccggcgtggagcgtctgccg
ctggcgggcctggccgtgtcggtcaaggatctgttcgacatccagggcatgaccaccgcc
gcgggctccaccgtgttgcgggaggcgccgcccgcgccggccgacagcccggccgtggcg
cgcctgcgccgcgcgggcgcagcgttcatcggccgcacgcacatggtggagttcgccttc
tccggcgtgggtgtgaatccgcacttcggcacgcccgccgcatttgacgcccgccacggc
gcgctgcccggccccgcgcgggtatgcgggggctcgtcgtcgggcgccggggtgtcggtg
gccacgggcgcggccttcattggcctgggctccgatacgggcggctcgatccgtatcccg
gccgcgctgaacggcatcgtgggtttcaagaacaccgcgcgcctcgtgcccaccgaaggc
gctgtccccttgtccaccacgctggacacggcctgcgcactcacccgcacggtgcgcgat
gccgtcgtggcacacgagatcctggcggcacggcgcgtcacgcgcagccccgcaccgctg
tcggcctggcggctggccgtacccgccacactgttcctggacggactggacgccaccgtg
gcacgcgccttcgaccgcacactgtcacgcctgcgcgcggccggcgcgcagatcaccgag
attgacctggcagaaaccgcccagttggccgatgtaaacgccaccggcgggttttccgcc
gccgaaagctacgcctggcaccgcgcgctgctggcacggcacggcaacgcctacgacccg
cgcgtgaagagccgcatcgagcgcggcgccagcatgtccgccgccgactacatcgatctg
ctgcacgcgcggcgcgcctggatcgcacgcatgcagaccgccatggccgacttcgacgcc
ctgctctcgcccaccgtccccatcgtggcgccccccatcgcatcggtcgcgccgggcagc
gagcgcgacgcggagttcttccgcgtcaatggattgctgctacgcaacaccagcgtggtc
aacatgctggacggctgcgccctgtccctgccgtgtcacgaagcgggcgaactgcccgtg
ggcctgatggtgtggcacggcgcactgcgcgacgacccggtgctgaacatcggcctgctg
atcgaacaagaactacaaaaacaatag

DBGET integrated database retrieval system