KEGG   Acidovorax ebreus: Dtpsy_1223
Entry
Dtpsy_1223        CDS       T00853                                 

Definition
(GenBank) ribosomal protein S2
  KO
K02967  small subunit ribosomal protein S2
Organism
dia  Acidovorax ebreus
Pathway
dia03010  Ribosome
Brite
KEGG Orthology (KO) [BR:dia00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Dtpsy_1223
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dia03011]
    Dtpsy_1223
Ribosome [BR:dia03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    Dtpsy_1223
  Bacteria
    Dtpsy_1223
  Archaea
    Dtpsy_1223
SSDB
Motif
Pfam: Ribosomal_S2 V_ATPase_prox LUD_dom DUF5131
Other DBs
NCBI-ProteinID: ACM32690
UniProt: B9MGL7
Position
1285697..1286449
AA seq 250 aa
MSVTMREMLEAGVHFGHQTRFWNPKMAPFIFGHRNKIHIINLEKSLPMFQEAQKFAKQLA
ANRGTILMVGTKRQARELVAEQAQRAGVPYVDQRWLGGMLTNFKTVKTSIKRLKDMKAQQ
EAGLESMSKKEQLMFSRELEKLEKDIGGIQDMAALPDAIFVIDVGYHKIAVSEAKKLGIP
LIGVVDSNHSPEGIDYVIPGNDDSAKAVALYARGIADAILDGRANAVTEVAKAVAAEGSD
EFVEVDENAA
NT seq 753 nt   +upstreamnt  +downstreamnt
atgtccgtcaccatgcgtgaaatgctggaagccggtgtccactttggccaccaaacgcgc
ttctggaaccccaagatggcccccttcatcttcggccatcgcaataagattcacatcatc
aacctggaaaagtcgctgccgatgttccaggaggcgcagaagttcgctaagcagttggct
gccaaccgcggcaccatcctgatggtcggcaccaagcgccaggcccgcgaactggtggcc
gagcaggcccagcgcgctggcgtgccctatgtcgaccagcgctggctgggcggcatgctg
accaacttcaagaccgtcaagacctccatcaagcgcctgaaggacatgaaggcacagcag
gaagccggcctggagtccatgagcaagaaggagcagctgatgttctcgcgcgagctggaa
aagctcgagaaggacatcgggggcattcaggacatggctgcgctgcccgatgccatcttc
gtgatcgacgtgggctaccacaagatcgccgtgtccgaagccaagaagctgggcatcccg
ctgatcggcgtggtggactccaaccactcgcccgagggcattgactacgtgatccccggt
aacgacgactcggccaaggctgtggctctgtacgctcgcggcatcgccgacgctatcctt
gacggccgtgccaacgccgtgacggaagtggccaaggctgtggctgccgaaggctccgac
gaattcgtggaagtggacgagaacgccgcctaa

DBGET integrated database retrieval system