KEGG   Acidovorax ebreus: Dtpsy_1225
Entry
Dtpsy_1225        CDS       T00853                                 

Definition
(GenBank) uridylate kinase
  KO
K09903  uridylate kinase [EC:2.7.4.22]
Organism
dia  Acidovorax ebreus
Pathway
dia00240  Pyrimidine metabolism
dia01100  Metabolic pathways
Module
dia_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:dia00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Dtpsy_1225
Enzymes [BR:dia01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.22  UMP kinase
     Dtpsy_1225
SSDB
Motif
Pfam: AA_kinase FYRC
Other DBs
NCBI-ProteinID: ACM32692
UniProt: B9MGL9
Position
1287512..1288234
AA seq 240 aa
MTLATPAHKRILLKLSGEALMGDDAFGINRATIVRMVEEIAEVTRLGVQVAVVIGGGNIF
RGVAGGSVGMDRATADYMGMLATVMNALALADAMDKQGLTARVMSAIGIEQVVEPYVRPK
ALQYLEEGKVVVFAAGTGNPFFTTDTAAALRGAEIGAEVVLKATKVDGVYTADPMKDPSA
TRYAKLTFDEAMSRNLGILDATAFALCRDQKLPIRVFSIVKHGALKRVVMGEDEGTLVYA
NT seq 723 nt   +upstreamnt  +downstreamnt
atgaccctcgccacgccagcccacaagcgcatcctgctcaagttgtctggtgaggcgctc
atgggcgatgacgcattcggcatcaaccgtgccacgatcgtgcgcatggtcgaggagatc
gccgaggtcacccgcctgggcgtgcaagtggcggtggtgatcggcgggggcaacatcttc
cgcggtgtggcgggcgggtccgtgggcatggaccgcgccacggccgactacatgggcatg
ctggccaccgtgatgaacgcgctggccctggcggacgccatggacaagcaggggctgacg
gcccgcgtgatgtccgccataggcatcgagcaggtggtggagccctacgtgcgtcccaag
gcgctgcagtacctcgaagagggcaaagtggtggtgttcgccgccggaaccggcaacccc
ttcttcaccaccgacacggccgccgcgctgcgcggcgccgagatcggcgccgaggtggtg
cttaaggcgaccaaggtcgacggcgtgtacacggccgatccgatgaaggacccgtcggcc
acgcgctatgccaagctcacgttcgacgaggccatgagccgcaacctgggcatcctggac
gcgacggcctttgccctgtgccgcgaccagaagctgccgatccgcgtgttctccatcgtg
aaacatggcgcgctgaagcgcgtggtgatgggcgaagacgaaggcacgttggtgtacgct
tga

DBGET integrated database retrieval system