KEGG   Acidovorax ebreus: Dtpsy_1226
Entry
Dtpsy_1226        CDS       T00853                                 

Definition
(GenBank) ribosome recycling factor
  KO
K02838  ribosome recycling factor
Organism
dia  Acidovorax ebreus
Brite
KEGG Orthology (KO) [BR:dia00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:dia03012]
    Dtpsy_1226
Translation factors [BR:dia03012]
 Eukaryotic type
  Release factors
   Dtpsy_1226
 Prokaryotic type
   Dtpsy_1226
SSDB
Motif
Pfam: RRF MerR-DNA-bind
Other DBs
NCBI-ProteinID: ACM32693
UniProt: B9MGM0
Position
1288283..1288843
AA seq 186 aa
MTIADIKKTTEAKMDQSIAAFKNNLAKIRTGRANPQLLDTIHVEYYGSMVPLSQVANVAL
LDARTISVQPWEKNMGAKIEKAIRESDLGLNPASMGDLIRVPMPPMSEERRKEMTKLARS
EGEGAKVAIRNLRRDANEGVKKLVKDKLASEDDQKRAEADVQKTTDKHIAEIDALVAAKE
QEIMAI
NT seq 561 nt   +upstreamnt  +downstreamnt
atgacgattgccgacatcaagaagacgaccgaggcgaagatggaccagtccatcgccgcc
ttcaagaacaacctggccaagatccgcaccggccgcgccaacccgcagctgctcgacacg
atccatgtcgagtactacggatccatggtgccgttgtcccaggtggccaacgtggctttg
ctcgacgcgcgcaccatcagtgtgcagccatgggaaaagaacatgggtgccaagatcgag
aaggcgatccgtgaaagcgatctggggctgaacccggcctccatgggcgacctgatccgc
gtgcccatgccgccgatgagtgaagagcgccgcaaggagatgaccaagctggcgcgcagc
gaaggcgagggcgccaaggtggccatccgcaacctgcgccgcgatgccaatgaaggcgtc
aagaaactggtcaaggacaagctcgcctccgaggacgaccaaaagcgcgccgaggccgat
gtgcagaaaaccaccgacaagcacattgcagagatcgatgccttggtggcggccaaggag
caggaaatcatggcgatctga

DBGET integrated database retrieval system