KEGG   Acidovorax ebreus: Dtpsy_1227
Entry
Dtpsy_1227        CDS       T00853                                 

Definition
(GenBank) undecaprenyl diphosphate synthase
  KO
K00806  undecaprenyl diphosphate synthase [EC:2.5.1.31]
Organism
dia  Acidovorax ebreus
Pathway
dia00550  Peptidoglycan biosynthesis
dia00900  Terpenoid backbone biosynthesis
dia01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dia00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Dtpsy_1227
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Dtpsy_1227
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:dia01006]
    Dtpsy_1227
Enzymes [BR:dia01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.31  ditrans,polycis-undecaprenyl-diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific]
     Dtpsy_1227
Prenyltransferases [BR:dia01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   Dtpsy_1227
SSDB
Motif
Pfam: Prenyltransf
Other DBs
NCBI-ProteinID: ACM32694
UniProt: B9MGM1
Position
1288872..1289606
AA seq 244 aa
MPTVQGAIPHHIAIVMDGNGRWATRRFLPRLAGHRQGVESLRRCVHACVQRGVGVLTVFA
FSSENWNRPADEVSGLMDLLAKALTREVPQLARDGVQVHFVGEKSGISAQVREGLQRAEA
ATASNQRLVLNVCFNYGGRWDITQAAAALAARGEPITEASLHAAMGMAHVPDPDLLIRTG
GERRISNFLLWQAAYTELYFSDRLWPDFDEAALDEAIADFAARERRFGQTSDQVQAQQPG
SLRA
NT seq 735 nt   +upstreamnt  +downstreamnt
atgcccaccgtgcagggagccattccccaccacattgccatcgtcatggatggcaacggc
cgctgggcgacgcgccgcttcctgccgcgcctggcggggcatcggcagggcgtggaatcg
ctgcggcgctgcgtgcatgcttgcgtccaacgcggcgtgggcgtgcttaccgtgttcgcg
ttttcctccgagaactggaaccgtccggcggacgaggtgtccggtctcatggatctgctt
gccaaggcgctgacacgtgaggtgccgcaactggcccgggatggcgtgcaggtgcacttc
gtgggggaaaagtcgggcatttcggcgcaggtgcgcgaagggctccagcgtgccgaggcg
gccaccgcaagcaaccagcgactggtgctcaatgtctgcttcaactacggcggccgttgg
gacatcacgcaggccgcagctgcgcttgcagcgcggggcgagcccatcaccgaggccagc
ctgcatgccgccatgggcatggcccatgtgcccgatccggatctgctgatccgaaccggt
ggcgagcggcgcatcagcaacttcctgctgtggcaggccgcctataccgaactgtatttc
agtgaccgcctgtggcccgatttcgacgaggccgcactggatgaagccatcgcggacttc
gcggcgcgcgagcgccgctttggccaaacctccgaccaggtacaagcgcagcagcccggt
tcgctgcgtgcctga

DBGET integrated database retrieval system