KEGG   Acidovorax ebreus: Dtpsy_1228
Entry
Dtpsy_1228        CDS       T00853                                 

Definition
(GenBank) phosphatidate cytidylyltransferase
  KO
K00981  phosphatidate cytidylyltransferase [EC:2.7.7.41]
Organism
dia  Acidovorax ebreus
Pathway
dia00564  Glycerophospholipid metabolism
dia01100  Metabolic pathways
dia01110  Biosynthesis of secondary metabolites
Module
dia_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:dia00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dtpsy_1228
Enzymes [BR:dia01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.41  phosphatidate cytidylyltransferase
     Dtpsy_1228
SSDB
Motif
Pfam: CTP_transf_1 CarS-like
Other DBs
NCBI-ProteinID: ACM32695
UniProt: B9MGM2
Position
1289640..1290494
AA seq 284 aa
MLKQRVITALVLLAILLPALFYPSFVPFAVVTLVMMAAAAWEWGRLNGLGGGGSIGLGAA
CVVLCGLGWAAGWLHQPLPWLWLVGGAAWVLGGAALLRVGVAGWPQLPRGLRVAGGVLAL
WMAWLAVAQARVVGVNFLLSVLTLVWAADIFAYFAGRAFGLRFTRNKLAPSISPGKSWEG
VWGGMLGVLVLAAAWTAADGAWQASVPSLYSRLAAQGVWLLVVGALFMAAMSVVGDLVES
LIKRSAGVKDSSGLLPGHGGVLDRIDALLPTLPLAMMLSHFASA
NT seq 855 nt   +upstreamnt  +downstreamnt
atgctcaagcaacgtgtcatcaccgcgttggtcctgctggccattctgttgccggcattg
ttctatccctcgttcgtgccctttgccgtggtgacgctggtcatgatggctgcggcggcg
tgggaatggggtcggctcaacggcctcggcggtggcggcagcatcggcctgggggcggcg
tgtgtagtgctgtgcggcctcgggtgggccgcgggctggctgcaccagccgctgccctgg
ctgtggctggtgggcggcgctgcctgggtgctgggtggggccgccttgctgcgcgtgggc
gtggccggctggccgcagctgccgcgcgggctgcgcgtggccggcggcgtgctggcgctg
tggatggcctggctggccgtggcccaggcgcgcgtggtgggggtcaatttccttctgtcg
gttctgaccctggtgtgggcggccgatatctttgcctactttgccggccgcgcttttggc
ctgcgcttcacgcgcaacaagctggctccctctatcagccccggcaagagctgggaaggg
gtgtggggtggcatgctgggtgtgctggtgctggccgcggcctggaccgcggccgatggg
gcctggcaggccagcgtgcccagcctgtactcacgcctggcagcccagggcgtatggctg
ctagtcgttggcgcattgttcatggccgccatgagcgtggtaggcgacctggtggagtcg
ctcatcaagcgcagcgccggtgtcaaggacagcagcggcctgctgcctggccacggcggc
gtactggaccgcattgatgcgctgctgcccacgctgcccttggccatgatgctttctcat
ttcgcatccgcatga

DBGET integrated database retrieval system