KEGG   Acidovorax ebreus: Dtpsy_1229
Entry
Dtpsy_1229        CDS       T00853                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
dia  Acidovorax ebreus
Pathway
dia00900  Terpenoid backbone biosynthesis
dia01100  Metabolic pathways
dia01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dia00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Dtpsy_1229
Enzymes [BR:dia01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Dtpsy_1229
SSDB
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C
Other DBs
NCBI-ProteinID: ACM32696
UniProt: B9MGM3
Position
1290491..1291663
AA seq 390 aa
MKQRLTVLGSTGSIGTSTLDVVARHPDRYEVFALSAATQVDLMLAQCAQFRPRYAVMASS
AHARQLADKLQQSGLPTEVLQTPDALQAIASHEEVDAVMAAIVGAAGLAPCLAAARAGKR
LLLANKEALVVGGEVFMAAVREGGATLLPIDSEHSAIFQSLPEDPATWPRRVDHVLLTAS
GGPFRTRDPATLRDVTPAQACAHPNFSMGRKISIDSATMMNKALEVIEARWLFNLAPEQI
KVVIHPQQIIHSMVQFVDASIIAQLGTPDMRVPIACGLAWPERVESGAAPLDFTQLAALT
FEEADATRFPGLHLSWQALRAAPGTTAVLNAANEVAVAAFLEQRIRFDQIHALNLATLEA
VEPSNPDSLDALLALDARTRARSAELMARL
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgaaacaacgtctcacggtgctgggttctacgggatccatcggcaccagcaccctcgac
gtggtggcacgccaccccgatcgctacgaagtctttgcgctgagcgcggccacgcaggtg
gacctgatgctggcgcagtgcgcgcagttccgtccgcgctatgcggtgatggccagcagt
gcgcatgcgcgccagctggcagacaaactgcagcagagcggcttgcccaccgaggtgctg
caaacacccgatgcgctgcaagccattgcctcgcacgaagaggtggacgcggtcatggcg
gccatcgtgggcgcggcgggcctggcgccgtgcctggcggccgcgcgtgcgggcaagcgc
ctgctgctggccaacaaggaggcgctggtcgtcgggggcgaggtgttcatggccgcggtg
cgcgaaggcggcgccacgctgctgcccatcgacagcgagcattccgccatcttccagagc
ctgcccgaagaccccgccacctggccgcggcgcgtggaccacgtgctgctcaccgcgtcg
ggcgggccgtttcgcacgcgcgacccggccacgctgcgcgacgtgacgccggcgcaggcc
tgcgcgcatcccaacttctcgatgggccgcaagatttccatcgactcggccacgatgatg
aacaaggcgctggaggtgatcgaggcgcgctggctgttcaacctggcgcctgagcagatc
aaggtggtcatccacccgcagcagatcatccactccatggtgcagtttgtggacgcgtcc
atcattgcccagttgggcacgcccgatatgcgcgtgcccatcgcctgtggcctggcctgg
cccgagcgggtggaaagcggcgcggcgcccctggatttcacgcaactggcagcgctgacc
ttcgaagaagcggatgccacgcgctttcccgggctgcacctgtcctggcaggcgttgcgc
gcggcgcccggcaccacggccgtgctcaatgccgccaacgaggtggcagtggcggctttc
ctggagcagcgcatacgtttcgaccagatccatgcgctcaaccttgcaactttggaagcc
gtcgaaccgtccaacccggactcgctggacgcactgctggcgctggatgcgcgcacgcgt
gcgcggtccgcggagttgatggcgcgcttgtga

DBGET integrated database retrieval system