KEGG   Acidovorax ebreus: Dtpsy_1230
Entry
Dtpsy_1230        CDS       T00853                                 

Definition
(GenBank) membrane-associated zinc metalloprotease
  KO
K11749  regulator of sigma E protease [EC:3.4.24.-]
Organism
dia  Acidovorax ebreus
Brite
KEGG Orthology (KO) [BR:dia00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dia01002]
    Dtpsy_1230
Enzymes [BR:dia01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     Dtpsy_1230
Peptidases and inhibitors [BR:dia01002]
 Metallo peptidases
  Family M50: S2P protease family
   Dtpsy_1230
SSDB
Motif
Pfam: Peptidase_M50 PDZ_6 PDZ_2 PDZ
Other DBs
NCBI-ProteinID: ACM32697
UniProt: B9MGM4
Position
1291782..1293146
AA seq 454 aa
MLLTVVAFIVALGVLIAVHEYGHYRVAVACGVKVLRFSVGFGKPLLRWQPKGSPTEFVIG
AFPLGGYVRMLDEREAPVEPHERHLAFNTQPLRSRAAIVAAGPLANLLLAVLLYAAVNWS
GVDEPKAYLASPVAGSVAEQAGLRGGELVVSAGLGEGDFEPVRSFEDLRWTLTRGALDGQ
NVRLLLQPERGSTPREVLLRIDQLDVREADVQLYRRIGITAPWTRPVLGEVVPGGAAARA
GLRAGDVVLRLGSAAVVDGVQLRELIRASVQAGQPLTQVWRIERDGQPRDLEVTPEVAQE
AGGAVGRVGAYVGAPPEMVNVHYGPLEGLWKGTVRTWEVSVLTLRMMGRMVIGEASLKNL
SGPLTIADYAGRSASMGLTQYLSFLALISVSLGVLNLLPLPVLDGGHLMYYLWEGVTGRG
VSEAWMERLQRTGVAVLLLMMSIALFNDLTRLFG
NT seq 1365 nt   +upstreamnt  +downstreamnt
atgctgctgactgtcgttgccttcatcgttgcgttgggcgtgctgatcgccgtgcacgag
tacggccattaccgcgtggcggtggcctgcggtgtcaaggtcctccgcttctcggtcggc
tttggcaagcctttgctgcgttggcagcctaagggctcacccacggaattcgtcatcggc
gcctttccgctgggagggtacgtgcgcatgctggacgagcgtgaggcgcccgttgagccg
catgaacgccacctggccttcaatacccagcccctgcgttcgcgcgccgccatcgttgcc
gcggggccgctggccaatctactgctggcggtgctgttgtatgccgccgtcaactggagc
ggcgtggacgagcccaaggcctacctggccagccctgtagcggggtcggtggccgagcag
gcgggcctgcgcggcggcgaactggtggtgtccgccgggctgggcgagggcgatttcgag
cccgtgcgctcgttcgaagacctgcgttggacgctcacgcgcggcgcgctggacgggcag
aacgtgcggctgctgctgcagcctgagcgcggctcgacgccgcgcgaggtgctgttgcgc
atagatcagctggacgtgcgcgaggccgatgtgcagctgtatcgccgcatcggcatcacc
gcgccctggacgcgacccgtgctgggcgaggtcgtgccaggcggcgcggctgcgcgtgcg
gggctgcgcgctggtgatgtggttctgcgcctgggcagtgcggcggtggtggacggcgtg
caactgcgcgagctgatacgcgcgtccgtgcaggcgggccagccgctcacgcaggtctgg
cgcatcgagcgcgacggtcagccgcgcgacctggaagtcacgcccgaagtggcacaggag
gcgggcggcgccgtgggacgcgtcggcgcctatgtgggcgcgccgcccgagatggtgaac
gtgcattacggccccttggaagggctctggaaaggcacggtgcgcacatgggaggtgtcg
gtcctcacgctgcgcatgatgggccgcatggtgatcggtgaggcttcgctcaagaacctc
agcgggccgctgaccatcgccgattacgcaggccgttccgccagcatggggctgacccag
tacctcagcttcctcgcactcatcagcgtgagcctgggagtgctgaacctgcttccgctg
cccgtattggatggtgggcacctgatgtattatctttgggagggggtgacgggacggggc
gtgtccgaagcctggatggagcggctgcagcgcacaggcgtcgcggtgcttctcctcatg
atgtccatcgccctgttcaacgacctcacccggctttttggctaa

DBGET integrated database retrieval system