KEGG   Acidovorax ebreus: Dtpsy_1231
Entry
Dtpsy_1231        CDS       T00853                                 

Definition
(GenBank) outer membrane protein assembly complex, YaeT protein
  KO
K07277  outer membrane protein insertion porin family
Organism
dia  Acidovorax ebreus
Brite
KEGG Orthology (KO) [BR:dia00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dia03029]
    Dtpsy_1231
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dia02000]
    Dtpsy_1231
Mitochondrial biogenesis [BR:dia03029]
 Mitochondrial protein import machinery
  Outer membrane
   TOB/SAM complex
    Dtpsy_1231
Transporters [BR:dia02000]
 Other transporters
  Pores ion channels [TC:1]
   Dtpsy_1231
SSDB
Motif
Pfam: Omp85 POTRA
Other DBs
NCBI-ProteinID: ACM32698
UniProt: B9MGM5
Position
1293192..1295489
AA seq 765 aa
MRKHINRLGVRTASALAAMVFASQAAWALAPFKVQDIRVEGLQRVEPGTIFASLPLRVGD
EYNDDKGAAAIRALFALGLFKDVRLEASGNVLVVVVEERPTIADVDFAGTKEFDKDTLKK
AMRDVGLTEGRPFDKALADRAEQELKRQYINRSLYGAEVVTTVTPIERNRVNLTFTVTEG
EPAKIKEIRIVGNKAFSESTLKGLFDQDTGGWMSWYTKSNRYSRAKLNADLETLRSYYLA
RGFLEFRIESTQVAISPDKQDISITVNVNEGQSYVVSGVKLEGNYLDRDDEFKSLITIRP
GEPYNADKVAETTKAFTDHFGNFGFAFARVEAVPEIDRENNRVALVLRAEPSRRAYVRRI
NVSGNNRTRDEVIRREFRQFEASWYDGDKIKLSRDRVDRLGYFTEVNVETQEVPGAPDQV
DLVVNVAEKPTGSLQLGAGFSSAEKVSVSFAIKQENVFGSGNYLGVDVNTSKYRRTLVFS
TTDPYFTQDGISRTFDVYYRTAKPYEDQGGNYELVTAGTSVRLGVPFSETDTVFFGGGVE
QTRIKAGTNIPAAYLAYAQQFGETSLSVPLTIGWSRDDRDSALAPNSGRYQRLNSEWSVA
GDARYVRANYQYQQYIPLNKQFTIAFNGELGLGKGMNGRPFPVFKNFYSGGLGSVRGFDQ
GTLGPRDVTGASLGGPKKITLNAELIAPFPGAGNDRTLRWFTFVDAGNVYGEDESWELGD
MRVSAGLGLSWISPLGPLRIAIAQPVRKFAGDKIQKLQFQIGTSF
NT seq 2298 nt   +upstreamnt  +downstreamnt
atgagaaaacatatcaatcgcctgggcgtgcgtacggcatccgccctcgcagccatggtt
tttgcctcccaagccgcatgggcgctggcgccgttcaaggtgcaggacatccgtgtggaa
ggcctgcaacgtgtggagccgggcaccatcttcgcgtcgttgccgctgcgcgtgggtgac
gagtacaacgatgacaagggtgcagcagccatccgcgcgctgtttgcccttggcctgttc
aaggacgtgcgcctggaggcttccggcaacgtgctggtggtggtggtggaagagcgaccg
accatcgccgacgtggatttcgccggcaccaaggagttcgacaaggacaccctcaagaag
gccatgcgcgacgtgggtttgaccgaggggcgccccttcgacaaggccctggccgaccgc
gccgagcaggaactcaagcgccagtacatcaaccgcagcctgtacggcgcggaggtggtg
accaccgtcacgccgatcgagcgcaaccgcgtcaacctcaccttcaccgtcaccgagggc
gagcccgccaagatcaaggaaatccgcatcgtcggcaacaaggccttcagcgaatccacg
ctcaaggggctgttcgaccaggacacgggcggctggatgagctggtacaccaaatccaac
cgctattcgcgcgccaagctcaatgcagacctggagacactgcgctcgtactatctggcg
cgcggcttcttggagttccgcatcgaatccacgcaggtggcgatttcgcccgacaagcag
gacatctcgattaccgtcaacgtgaacgaaggccagagctatgtggtttcaggagtgaag
ttggaaggcaactacctggaccgcgatgacgagttcaagtcgctcatcaccatccgccct
ggcgagccctacaacgccgacaaggtggccgaaaccaccaaggctttcactgaccacttc
ggcaacttcggctttgccttcgcgcgtgtggaggccgtgcccgagatcgatcgcgagaac
aaccgcgtggccctggtgctgcgcgcagagccctcgcgccgcgcctatgtgcgccggatc
aacgtgagcggtaacaaccgcacccgcgacgaagtcatccgccgcgaattccgccagttt
gaagcctcctggtacgacggcgacaagatcaagctgtcgcgcgaccgcgtggaccgcctg
ggctatttcactgaggtgaatgtggaaacccaggaggtgccgggcgcgcccgaccaggta
gacctggtggtgaacgtggccgagaagcctacgggctcgctgcaactgggggcgggcttt
tccagcgccgagaaggtctcggtgtcgtttgccatcaagcaggagaacgtcttcggttca
ggcaactaccttggcgtggacgtcaacaccagcaagtaccgtcgcacgctggtgttttcc
accaccgatccgtacttcacgcaggatggcatctcccgtaccttcgacgtgtactaccgc
acggccaagccctatgaagaccagggcggaaactatgaactggtcaccgcgggcaccagt
gtgcgcttgggcgtacccttcagcgagaccgacaccgtgttcttcggggggggagtggag
cagacgcgcatcaaggccggtaccaatatccccgccgcctacctcgcctatgcgcagcag
tttggtgaaaccagcctatccgtgccgctcaccattggctggtcgcgcgatgaccgtgac
agtgcgttggcaccgaactccgggcggtaccagcgcctgaactccgaatggtccgtagcc
ggcgatgcgcgctatgtgcgagccaactaccaataccagcagtacattcccttgaacaag
cagttcaccatcgccttcaacggcgagttgggcttaggcaagggcatgaatggccgtccc
ttcccggtgttcaagaatttctactccggcggcctgggctcggtgcgcggcttcgaccag
ggcacactgggtccgcgggacgtgaccggtgcgtcgctgggcggccccaagaagatcacg
ctgaatgccgaactcatcgcgccgttccccggcgccggcaacgaccgcacgctgcgctgg
ttcactttcgtggacgcgggcaacgtgtacggcgaggatgagagctgggagctgggcgac
atgcgcgtctcagctggtctgggcctgagctggatttccccgctgggcccgctacgtatc
gccatcgcgcaaccggtgcgcaagttcgccggcgataaaatccagaaactgcaattccag
atcggaacgtctttctaa

DBGET integrated database retrieval system