KEGG   Acidovorax ebreus: Dtpsy_1233
Entry
Dtpsy_1233        CDS       T00853                                 

Definition
(GenBank) UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
  KO
K02536  UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [EC:2.3.1.191]
Organism
dia  Acidovorax ebreus
Pathway
dia00540  Lipopolysaccharide biosynthesis
dia01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dia00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    Dtpsy_1233
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:dia01005]
    Dtpsy_1233
Enzymes [BR:dia01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.191  UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase
     Dtpsy_1233
Lipopolysaccharide biosynthesis proteins [BR:dia01005]
 Lipid A
  Dtpsy_1233
SSDB
Motif
Pfam: LpxD Hexapep Hexapep_2 Fucokinase
Other DBs
NCBI-ProteinID: ACM32700
UniProt: B9MGM7
Position
1296035..1297015
AA seq 326 aa
MSLRLGQIVDALGGSLEGGERDTEILRIAPLESSGPGDLSFLSNPRYQSQLAASQAACVI
VAPAMRNAALERGACIVVEQPYTYFAHVTQLWVRAHGQGAPAGIHPSAVVDPQARVAPTA
SIGPLCVVERGAVIGAHTVLKSRVTVGERCTVGERCILHPGVVIGADGFGFAQQRGEWIK
IEQLGAVRIGNDVEIGANTCIDRGALDDTVIEDGVKLDNLIQIAHNVHIGRHTAMAGCSA
VAGSTRIGAHCTIAGAASIVGHLQLADNVHISTNTVVTHSITQPGQYTGVFPMDDNAKWE
KNAATLRQLYRLRERIKALEQTRKDG
NT seq 981 nt   +upstreamnt  +downstreamnt
gtgagcttgcgactcgggcagatcgtcgatgcacttgggggcagcctggaaggaggggag
agggataccgaaatcctccgcatcgccccgctggaatcctccggcccgggtgacctgtcc
ttcctgagcaatccgcgctaccagtcacaactggccgcctcccaggcggcctgtgtcatt
gtggcacccgcgatgcgcaatgcagccttggagcgcggcgcttgcatcgttgtggagcag
ccctacacgtactttgcacacgtgacgcagctgtgggtgcgcgcgcatggccaaggtgcg
cctgcgggcatccaccccagcgccgtagtcgatccgcaagcccgggtggccccgacagcc
tcgatcggtcccctgtgcgtggtcgagcgcggcgcagtgattggagcgcacacggtgctc
aagtcgcgggtgacggtcggcgagcgttgcacggttggcgagcgctgcatcctgcaccct
ggcgtggtcatcggggccgacggcttcggctttgcgcagcagcgcggcgaatggatcaag
atcgagcaactgggcgcggtgcgcatcggcaacgatgtggagattggtgcgaacacctgc
atcgaccgcggagcgctcgacgacacggtcatcgaagacggcgtcaagctcgacaacctg
atccagatcgctcacaacgtgcacatcggccgccacaccgccatggcgggctgttccgcg
gtggcgggcagcacccgcatcggcgcgcactgcacgattgcaggggccgcgtccatcgtg
gggcacttgcagttggcggacaatgtgcacatctccaccaacacggtggtgacgcactcg
atcacgcaaccggggcagtacaccggggtgtttcccatggacgacaatgcgaagtgggaa
aagaacgcggccacgctgcggcagctgtaccggctgcgtgaacgcatcaaggctctcgaa
caaacacgaaaagacggctag

DBGET integrated database retrieval system