KEGG   Acidovorax ebreus: Dtpsy_1234
Entry
Dtpsy_1234        CDS       T00853                                 

Definition
(GenBank) beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
dia  Acidovorax ebreus
Pathway
dia00061  Fatty acid biosynthesis
dia00780  Biotin metabolism
dia01100  Metabolic pathways
dia01212  Fatty acid metabolism
Module
dia_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:dia00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Dtpsy_1234
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Dtpsy_1234
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:dia01004]
    Dtpsy_1234
Enzymes [BR:dia01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     Dtpsy_1234
Lipid biosynthesis proteins [BR:dia01004]
 Fatty acid synthase
  Component type
   Dtpsy_1234
SSDB
Motif
Pfam: FabA 4HBT MaoC_dehydratas
Other DBs
NCBI-ProteinID: ACM32701
UniProt: B9MGM8
Position
1297031..1297471
AA seq 146 aa
MMDIHQILKLLPHRYPFLLVDRVNELERGKRILAIKNVTINEPFFTGHFPARPVMPGVLI
LEALAQAAGLLSFDMMGEAPGDDKVFYFVGIDGARFKRPVEPGDQLILDVELDRIKGGIY
KFKGVARVGDSVACEAEIMCTMRTVA
NT seq 441 nt   +upstreamnt  +downstreamnt
atgatggatatccaccaaattctcaaactcctgccccaccgctatccgttcctgctggtg
gatcgggtgaatgagctcgaacgcggcaagcgcatcctggccatcaagaacgtgaccatt
aacgagccgtttttcacggggcacttccccgcacgcccggtgatgcccggggtgttgatt
ctcgaagcactcgcgcaggcggcgggcttgctgtcgttcgacatgatgggtgaggcgccg
ggcgacgacaaggtcttttacttcgtcggtatcgatggtgcgcgcttcaagcgccccgtg
gagccaggcgatcagctcatcctcgacgtggaactggaccgcatcaagggcggcatctac
aagttcaagggcgtcgcgcgcgtgggcgacagcgtcgcgtgcgaggccgagatcatgtgc
accatgcgcacggtggcctga

DBGET integrated database retrieval system