KEGG   Acidovorax ebreus: Dtpsy_1235
Entry
Dtpsy_1235        CDS       T00853                                 

Definition
(GenBank) acyl-(acyl-carrier-protein)--UDP-N-acetylglucosamine O-acyltransferase
  KO
K00677  UDP-N-acetylglucosamine acyltransferase [EC:2.3.1.129]
Organism
dia  Acidovorax ebreus
Pathway
dia00540  Lipopolysaccharide biosynthesis
dia01100  Metabolic pathways
dia01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:dia00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    Dtpsy_1235
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    Dtpsy_1235
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:dia01005]
    Dtpsy_1235
Enzymes [BR:dia01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.129  acyl-[acyl-carrier-protein]---UDP-N-acetylglucosamine O-acyltransferase
     Dtpsy_1235
Lipopolysaccharide biosynthesis proteins [BR:dia01005]
 Lipid A
  Dtpsy_1235
SSDB
Motif
Pfam: Acetyltransf_11 Hexapep
Other DBs
NCBI-ProteinID: ACM32702
UniProt: B9MGM9
Position
1297489..1298280
AA seq 263 aa
MAPNIHSTALVDAAAQLDPTVTVGPYAVIGPHVQIGAHTSIGAHCVIEGHTRIGEDNRIF
QFSSLGAAPQDKKYAGEPTRLEIGHRNTIREFCTFNVGTVQDRGVTSIGDDNWIMAYVHI
AHDCVVGNQTILANNATLAGHVQVGDQAIIGGLTGVHQFSRIGAHVMAGFASRISQDVPP
FMMVDGNPLAVRGLNLEGLRRRGFSAQRMAGIKQAYRLLYRQGLTLEAALSAMADVPHSH
PEAEGDIALLRDFVIASQRGIAR
NT seq 792 nt   +upstreamnt  +downstreamnt
ttggcgcccaacatccattccacggccctcgttgatgcggccgcgcagttggaccctact
gttacggtggggccgtatgcggttatcggcccccacgtgcaaatcggcgcgcacacgtcg
attggcgcgcactgcgtgatcgagggccatacacgcattggcgaagacaaccgcatcttc
cagttcagttcgctgggagcagctccgcaggacaagaaatacgcgggcgagcccacgcgt
ttggagatcggccaccgcaacacgatccgcgagttctgcaccttcaacgtcgggaccgtg
caggaccggggcgtcacctccatcggggacgacaactggatcatggcctatgtgcacatc
gcgcacgactgcgtggtgggcaaccagaccatcctggccaacaacgccacgctggccgga
catgtgcaggtgggtgaccaggccatcatcggcggcttgaccggcgtgcaccagttttca
cgcatcggcgcccacgtcatggcgggctttgccagccgcatctcgcaagatgttccgccc
ttcatgatggtggacggcaatccgctggccgtgcgcgggctgaacctggaagggctgcgc
cgacggggtttttccgcgcagcgcatggcgggcatcaagcaggcctaccgcctcctgtac
cgccagggcctcacgctggaggccgcgctgtcggccatggccgacgtgccgcattcgcat
cccgaggcggaaggcgatatcgccctgctgcgtgatttcgtgatcgcgtctcagcgcggt
atcgcgcgctga

DBGET integrated database retrieval system