KEGG   Acidovorax ebreus: Dtpsy_1237
Entry
Dtpsy_1237        CDS       T00853                                 

Definition
(GenBank) Ribonuclease H
  KO
K03470  ribonuclease HII [EC:3.1.26.4]
Organism
dia  Acidovorax ebreus
Pathway
dia03030  DNA replication
Brite
KEGG Orthology (KO) [BR:dia00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Dtpsy_1237
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dia03032]
    Dtpsy_1237
Enzymes [BR:dia01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     Dtpsy_1237
DNA replication proteins [BR:dia03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    RNase H
     Dtpsy_1237
   Elongation factors (archaeal)
     Dtpsy_1237
SSDB
Motif
Pfam: RNase_HII
Other DBs
NCBI-ProteinID: ACM32704
UniProt: B9MGN1
Position
1299428..1300057
AA seq 209 aa
MRSRTSLLEQAALDWHPPGLVAGVDEAGRGPLAGPVVAAAVILDDLQPIAGLADSKVLTA
ARREKLYDEIRAKALCCSIAEASVEEIDQHNILQATMLAMRRAVLGLRLKPVRVLVDGNR
LPPLDVPAEAIVKGDALVASISAASILAKVTRDRWCAQLHQQYPVYGFAGHKGYGTAEHL
AALEVHGACPQHRRSFAPVARALQAPVAA
NT seq 630 nt   +upstreamnt  +downstreamnt
atgcgatccagaacctccttgcttgagcaggccgccctggactggcatccgcccggcctc
gtcgccggcgtggatgaggccgggcgtgggccgttggccggccccgtggtggcggctgcg
gtgatcctggacgacctgcagcccatcgctggcctggccgactccaaggtgcttacggcc
gcacggcgcgagaaactctacgacgagatccgtgccaaggcgctgtgctgcagcattgcg
gaagcatcggtggaggagatcgatcaacacaatatcctgcaagccacgatgctggccatg
cgccgtgcggtgctggggctgcggctgaagccggtgcgggtgttggtggatggcaatcgc
ttgccgccgctggacgttccggcggaggccatcgtcaagggcgatgcgctggtcgcatcg
atctcagccgcctccattcttgcaaaggtcacgcgcgaccgctggtgcgcgcaattgcac
cagcaatacccggtgtatggctttgccggccataagggctacggcacggcagagcacctg
gccgcgctggaagtgcatggggcctgtccccagcaccggcgctcgttcgcgccggtggcg
cgcgccttgcaggcgcccgtcgccgcctga

DBGET integrated database retrieval system