KEGG   Acidovorax ebreus: Dtpsy_1238
Entry
Dtpsy_1238        CDS       T00853                                 

Definition
(GenBank) tRNA/rRNA methyltransferase (SpoU)
  KO
K03437  RNA methyltransferase, TrmH family
Organism
dia  Acidovorax ebreus
Brite
KEGG Orthology (KO) [BR:dia00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dia03016]
    Dtpsy_1238
Transfer RNA biogenesis [BR:dia03016]
 Prokaryotic type
  tRNA modification factors
   Methyltransferases
    Dtpsy_1238
SSDB
Motif
Pfam: SpoU_methylase
Other DBs
NCBI-ProteinID: ACM32705
UniProt: B9MGN2
Position
1300088..1300870
AA seq 260 aa
MHATPAFIQSRDNALLKELRRLSQDSSAYRKQGRVWLEGDHLCSAALARGQKPAIAVFSE
SFWPQALAEYARAATKNVVIADVLWSDISALESPAPMGFVLPLPEAEGLDGRMPTVVLDR
LQDAGNVGSILRSASAFGFTQVAALKGTAALWSGKVLRAGMGAHFALRLVEGLAPADIDR
LEVPLLATSSHEGDFLHRAALPWPCGWIMGHEGQGVSPALQQRARRHIRIAQPGGEESLN
VGAAAAICLHASAAARDSAG
NT seq 783 nt   +upstreamnt  +downstreamnt
atgcacgccacgcctgctttcatccaatcgcgcgacaacgcactgctcaaggagttgcgc
cgcctgtcgcaggacagttccgcataccgcaagcagggccgtgtgtggctggagggagat
catctgtgcagcgccgcgctggcgcgtggacaaaagccagcgatagcggtgttttcggag
tcattttggccccaagcgctcgctgaatatgcgcgagcagctacgaaaaatgtagtgatc
gctgatgtgctctggagtgacatcagcgctctggaatctccggcgcccatgggttttgtg
ttgccgctgcctgaagcggaggggttggacggcaggatgccgactgtcgtgctcgatcgc
ctgcaggatgcgggtaacgtgggctccatcctgcgcagcgcatcggcattcgggttcacg
caagtggcggcgctgaaaggcaccgcagcgctctggagtggcaaggtgctgcgcgcgggc
atgggcgcccatttcgccctgcggctggtcgaggggttggcgcccgcagacatcgaccgg
ctagaggtcccgttgctggcaaccagctcgcacgagggcgacttcctccatcgcgcagcc
ttgccctggccgtgtggctggatcatgggccacgaagggcagggcgtctcgcccgccctg
cagcagcgtgcgcggcgccacatccgcattgcccagcctgggggcgaggagtcgctcaac
gtgggggccgccgcggccatctgcctccatgccagcgctgcggcgcgcgactcggctggc
tga

DBGET integrated database retrieval system