KEGG   Acidovorax ebreus: Dtpsy_1239
Entry
Dtpsy_1239        CDS       T00853                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dia  Acidovorax ebreus
SSDB
Other DBs
NCBI-ProteinID: ACM32706
UniProt: B9MGN3
Position
complement(1300928..1301302)
AA seq 124 aa
MKRPTFALLGLLLTLSAPHALAQDAVIGRYGHHVYVMVPTDKAGNRAYVQRAAANACEGK
SLCHASVWAESLDRPEGAPPHPRYEENKLAAFQRNRNAGVEASHSINCRLFARDINVPCL
AGTE
NT seq 375 nt   +upstreamnt  +downstreamnt
atgaagcgacccactttcgccctgctgggactgttgctcacactgagcgccccgcatgcc
ctggcccaagatgccgtgatcggccgatatggccatcatgtgtatgtgatggtgccgacc
gacaaggcaggcaaccgcgcctatgtgcagcgcgccgcggcgaatgcctgcgaaggcaag
agcctgtgccatgcgtccgtgtgggccgagagcctggaccgccccgaaggcgcgccgccc
catccgcgctacgaagagaacaagctggcggcattccaacgcaaccgcaacgccggcgtg
gaagcaagccactcgatcaattgccggctgttcgcgcgcgacatcaatgtgccctgtctc
gcgggcactgagtag

DBGET integrated database retrieval system