KEGG   Acidovorax ebreus: Dtpsy_1240
Entry
Dtpsy_1240        CDS       T00853                                 

Definition
(GenBank) ribonuclease R
  KO
K12573  ribonuclease R [EC:3.1.13.1]
Organism
dia  Acidovorax ebreus
Pathway
dia03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:dia00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    Dtpsy_1240
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dia03019]
    Dtpsy_1240
   03016 Transfer RNA biogenesis [BR:dia03016]
    Dtpsy_1240
Enzymes [BR:dia01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     Dtpsy_1240
Messenger RNA biogenesis [BR:dia03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     Dtpsy_1240
Transfer RNA biogenesis [BR:dia03016]
 Prokaryotic type
  tRNA degradation factors
   Dtpsy_1240
SSDB
Motif
Pfam: RNB CSD2 OB_RNB S1 RNase_II_C_S1 OB_Dis3
Other DBs
NCBI-ProteinID: ACM32707
UniProt: B9MGN4
Position
1301789..1304083
AA seq 764 aa
MYIKKNHSESSVAKVSLDEIEGTVQGHRDGHGFVLRDDGQPDIYLPANEMRAVLHKDRVR
VRIARQDRRGRPEGRVVEILERPPQPIIGRLLQESGVWLVAPEDKRYGQDVLIPKGATGA
AATGQVVVVELTEPPALFGQPVGRVVEVLGEVDDPGMEVEIAVRKYGVPHEFSEACLDQA
KALPDKVRAQDKRRRVDLTDVPLVTIDGEDARDFDDAVYCEPAKIGRAKGWRLLVAIADV
SHYVETGNAIDIDAYDRATSVYFPRRVIPMLPEKLSNGLCSLNPHVERLCMVCDMMVTAK
GEIHAYQFYPAVMLSHARLTYTEVAAVLANTRGPEALKHQERVGNLLNLYEVYRALLAAR
QARGAVDFETTETQIVCDDNGRIEKIVPRVRTEAHRLIEEAMLAANVCSADFIGHAGRAG
LYRVHEGPTPEKQEILRAYLKAMGVGMSIGDDPRPAEFQAIAEATKDRVDAQQIHTMLLR
SMQQAIYTPVNSGHFGLAFEAYTHFTSPIRRYPDLLVHRVIKSILSGTKYVLPALPTPGE
AQFKLAKRLASKGGESSARPSKTGGVISVRETQAWEAAGLHCSANERRADEASRDVEAWL
KCQYMREHLGEEYSGVVSAVTSFGIFVTLDALYVEGLVHITELGGEYFKFDEARQELRGE
RTGIRYAIGARVRVQVSRVDLDGRKIDFRLVHEAGDGFSTKGPKSRDGAKRGSSAAALDG
RSASVPTARESREEGSRRRPHKQALAGKKAAGGKNPSKGRKSRG
NT seq 2295 nt   +upstreamnt  +downstreamnt
ttgtatatcaaaaaaaatcactctgaatcatccgtcgccaaagtttcactggacgagatc
gaaggcaccgtccagggacaccgcgacgggcatggcttcgtcctgcgcgatgacggccag
cctgacatttaccttcctgccaatgagatgcgggcggtattgcacaaggaccgggtgcgc
gtgcgcatcgcgcgccaggaccggcgcggccggcctgaaggccgcgtggtcgagattctg
gagcgcccgccccaacccatcatcgggcgccttcttcaggagagcggtgtctggctggtc
gcccctgaggacaaacggtacggccaggacgtgctgattcccaagggtgctacgggggct
gctgcgacgggacaggtcgtggtggtggaactgaccgagccgccggctttgtttgggcaa
cccgtggggcgggtggtcgaagtgctgggggaggtagatgaccccgggatggaggtggaa
attgccgtgcgcaaatacggggttccgcacgaattctccgaagcgtgccttgaccaggcg
aaggcgctgccggacaaggtgcgcgctcaggacaagcgtcgacgcgttgatctgacggat
gtccccctggtcaccatcgatggtgaagatgcgcgcgacttcgacgacgcggtgtattgc
gagcccgccaagatcgggcgcgccaaggggtggcgcctgctcgtggccatcgcggacgtg
agccactatgtggagacgggcaatgccatcgatattgacgcctacgaccgggcgaccagc
gtttatttcccgcggcgcgttatccccatgctgccggagaagctctccaacgggctgtgc
tcgctgaacccccatgtcgagcgcctgtgcatggtgtgcgacatgatggttaccgccaaa
ggtgaaattcacgcctatcagttctatcctgcggtcatgctcagccacgcgcggcttacc
tataccgaggtggctgcggtgctggccaatacgcgcggcccggaagcgctgaagcatcaa
gagcgcgtgggcaacctgctcaacctctacgaggtctaccgcgcattgctagccgcgcgg
caggcgcgcggcgccgtggacttcgagacgaccgagacgcaaatcgtctgtgatgacaat
ggccgtatcgagaaaatcgtcccccgtgtacgcaccgaggcgcaccgcctgattgaggag
gcgatgctcgccgccaacgtctgcagcgccgatttcatcggtcatgccggccgggcgggg
ctgtatcgcgttcatgaggggcctacgccggagaagcaagagatcctgcgtgcatatctc
aaagccatgggtgttggcatgtcgatcggggacgatccgcggccggcagaattccaggcg
attgccgaggccaccaaggaccgggtggatgcgcagcagatccacaccatgctgctgcgt
tcgatgcagcaggcgatctacacgcctgtcaacagcggtcacttcggtttggcattcgaa
gcctatacacacttcaccagtcctattcgccgctacccggatctgctggtgcatcgcgtg
atcaagtccatcttgagcggcaccaaatatgtgctgcccgcgctgccgacgccgggggag
gctcagttcaagctggccaagcgtctggcttccaagggcggagaatcctctgcacgccct
tccaagacgggtggcgttatcagcgtccgggagacgcaggcgtgggaggccgcgggactg
cactgcagtgcgaacgaacgccgtgcggacgaggccagtcgtgacgtggaagcatggctc
aagtgccagtacatgcgtgagcatctgggtgaggagtacagcggtgtcgtcagcgcggtg
acgagcttcggcatcttcgtgacgcttgatgccctctatgtggaagggctggtgcacatc
acggaactgggtggggagtactttaagttcgatgaggcgcggcaagaactgcggggggag
cgcacgggtatccgctatgcgattggtgcacgcgtgcgtgttcaggtcagccgcgtcgac
ctcgatggccgcaagatcgacttccggctggtgcatgaagccggcgatggtttctccacc
aaaggccccaagtccagggacggcgcgaaacgcgggtcctcggcagcggccttggatggt
cgatccgcctcggtgcccacggcccgggaaagcagagaggaggggagccggcggcgcccg
cacaagcaggccttggccggcaaaaaagcggcaggtggcaagaacccctctaagggccgc
aaatcccgcggttga

DBGET integrated database retrieval system