KEGG   Acidovorax ebreus: Dtpsy_1242
Entry
Dtpsy_1242        CDS       T00853                                 

Definition
(GenBank) putative cytochrome c
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Other DBs
NCBI-ProteinID: ACM32709
UniProt: B9MGN6
Position
1304873..1305610
AA seq 245 aa
MAEKFLRPLLHAAGALCMLLAASVAAAPAVDMAPRVQACTACHGKQGRATPDGYFPRIAG
KPAGYLHNQLLNFRDGRRSYPQMAYLLQHLTDDYLQEMADHFARLDLPYAPPVAAAVSAA
TLAQGERLVRWGDASRQLPACVQCHGDALAGVAPFIPGLLGLSRDYVSSQLGAWQTGLRR
AHAPDCMARIASKLTADDVSSIAAWLSSRPVPSRFTPAPAFKAPLPIPCGGMGSPALQAG
AEQVQ
NT seq 738 nt   +upstreamnt  +downstreamnt
gtggctgagaaattcttacgccccttgctgcacgcggcaggggcgctgtgcatgctgctc
gctgcctcggtggccgccgcgccggccgtggatatggcgccgcgtgtgcaggcctgcacc
gcgtgccacggcaagcaggggcgtgccactcctgacggttatttccctcgcatcgcggga
aagccggcgggatatctgcacaaccaactgctcaatttccgggatggccggcgcagctat
ccgcagatggcgtacttgctgcagcatctgacggatgactatctccaggagatggcggac
cacttcgcaagactggacctgccctatgcgccaccggtagctgcagctgtatcagcagcc
acactggcgcagggagagaggcttgtgcggtggggggatgcgagccgccaattgccggcc
tgcgtgcagtgccatggcgatgctctggcgggcgtcgcgcctttcattccagggttgctg
gggctgtctcgcgattatgtgagcagccagttgggggcctggcagaccggtctgcggcgc
gcccatgcgccagattgcatggcgcgcatcgccagcaaactgaccgctgacgatgtaagt
tccatcgcggcgtggctgtcctcccgtcctgttccctcaaggttcacaccggcgccggca
ttcaaggcgccgctgccaataccctgtggcggcatgggttctccggcgttgcaggctggc
gcggagcaggtgcaatga

DBGET integrated database retrieval system