KEGG   Acidovorax ebreus: Dtpsy_1244
Entry
Dtpsy_1244        CDS       T00853                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K03671  thioredoxin 1
Organism
dia  Acidovorax ebreus
Brite
KEGG Orthology (KO) [BR:dia00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:dia03110]
    Dtpsy_1244
Chaperones and folding catalysts [BR:dia03110]
 Protein folding catalysts
  Protein disulfide isomerase
   Dtpsy_1244
SSDB
Motif
Pfam: Thioredoxin Glutaredoxin Thioredoxin_9 OST3_OST6 Thioredoxin_7 Thioredoxin_2
Other DBs
NCBI-ProteinID: ACM32711
UniProt: B9MGN8
Position
1306892..1307281
AA seq 129 aa
MGSEAFLPDVASHASATPQWWVVCLCAQWCGVCREYRQAFDQTARAWPQMRFEWVDVEDE
EEVVGDLDVETFPTVLIADGRAARFLGPLLPQATVLGRMLQSLQQASQVATMDSTAQDLF
ERIRSSRQG
NT seq 390 nt   +upstreamnt  +downstreamnt
atgggctccgaagcctttttgccggatgttgcttcacatgccagcgcaacgccgcagtgg
tgggttgtgtgtctgtgcgcacaatggtgcggtgtatgccgtgaataccgtcaagccttc
gaccaaactgcgcgcgcttggccgcaaatgcgctttgaatgggtggatgtggaggatgag
gaagaagtggtcggcgacctggatgtagagactttccctactgtcttgattgccgatggc
agggctgcacggtttctgggacccctattgcctcaggccacagtgttggggcgcatgctt
caaagcttgcagcaggcttcccaagtagccacgatggacagcacagcgcaggaccttttc
gagaggatacggtcaagccgccagggttga

DBGET integrated database retrieval system