KEGG   Acidovorax ebreus: Dtpsy_1245
Entry
Dtpsy_1245        CDS       T00853                                 

Definition
(GenBank) protein of unknown function DUF150
  KO
K09748  ribosome maturation factor RimP
Organism
dia  Acidovorax ebreus
Brite
KEGG Orthology (KO) [BR:dia00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:dia03009]
    Dtpsy_1245
Ribosome biogenesis [BR:dia03009]
 Prokaryotic type
  Other maturation factors
   Dtpsy_1245
SSDB
Motif
Pfam: DUF150 DUF150_C
Other DBs
NCBI-ProteinID: ACM32712
UniProt: B9MGN9
Position
1307472..1308065
AA seq 197 aa
MALQQIVEQTVAGLGYDLVEIERSAGGLLRITIDLVWVPPTDEVSAAVGVEQFITVEDCE
KVTRQLQFALEVEGVDYTRLEVSSPGIDRLLRNEADFKRFEGEVIDITLKQPMGAAAGGQ
VHANRKKFRGTLERADSGGWQIVWSDEPPVKPGQRISKKRVPAPLQALGFTLDELREARL
APIVDFKGRGTKPGEPG
NT seq 594 nt   +upstreamnt  +downstreamnt
gtggcattgcagcaaatcgtagaacaaaccgtggccgggctgggctatgacctggtggag
attgagcgctccgccggagggttgctgcgcattaccattgacctggtttgggtgccgccc
acggatgaggtgtccgctgccgtaggcgtcgagcaattcattaccgtagaggattgtgaa
aaggtcacccgtcagctgcagtttgcgctggaggtggagggggtggactacacgcggttg
gaagtctcatctcctgggatcgaccgcttgttgcgcaacgaggcggacttcaagcgtttc
gagggcgaggtgatcgacatcaccctcaagcagcccatgggcgctgcggcgggagggcaa
gtgcatgccaaccgcaagaaattccggggaacgctcgagcgtgccgattcgggcggttgg
cagattgtctggagcgatgagccgcccgtgaagccggggcagcgcatcagcaagaagcgc
gtgccagcgcctttgcaggcccttggtttcactttggatgagttgcgcgaggcgcggctt
gcgccgatcgtggatttcaaaggacgagggaccaagcccggagagccgggctga

DBGET integrated database retrieval system