KEGG   Acidovorax ebreus: Dtpsy_1246
Entry
Dtpsy_1246        CDS       T00853                                 

Definition
(GenBank) NusA antitermination factor
  KO
K02600  transcription termination/antitermination protein NusA
Organism
dia  Acidovorax ebreus
Brite
KEGG Orthology (KO) [BR:dia00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:dia03021]
    Dtpsy_1246
   03009 Ribosome biogenesis [BR:dia03009]
    Dtpsy_1246
Transcription machinery [BR:dia03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     Dtpsy_1246
Ribosome biogenesis [BR:dia03009]
 Prokaryotic type
  rRNA transcription factors
   Dtpsy_1246
SSDB
Motif
Pfam: NusA_N KH_5 HHH_5 KH_2 S1 KH_4 RNA_pol_A_CTD
Other DBs
NCBI-ProteinID: ACM32713
UniProt: B9MGP0
Position
1308135..1309619
AA seq 494 aa
MNRELLMLVEAISREKNVERDVVLGAVESALAQATKKLYQGEVDIRVSIDRDSGEYETFR
RWLVVPDDAGLQNPDAEELLMDARERVADIEVGEYIEEAVESVPIGRIGAMAAKQVILQK
IRDAEREMLLNDFMSRGEKIFTGTVKRMDKGDIIVESGRVEGRLRRGEMIPKENLRNGDR
VRAMIMEVDLTLRGAPIILSRSAPEFMIELFRNEVPEIEQGLLEIKSCARDPGSRAKIAV
LSHDKRVDPIGTCVGVRGTRVNAVTNELAGERVDIVLWSDDPAQFVIGALAPANVTSIVV
DEEKHAMDVVVDEENLAIAIGRGGQNVRLASDLTGWKINIMDAAESAQKQANETDAARRL
FMEKLDVDEEIANILIEEGFASLEEVAYVPLQEMLEIESFDEDTVNELRARAKDALLTME
IVREESVESVSQDLRDLEGLTPELIAKLAEGGVHTRDDLADLAIDELTELTGQSAEDATA
LIMKAREHWFTGQE
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgaatcgcgagttgttgatgttggtagaagccatttcgcgcgaaaagaacgtggagcgc
gatgtggtcctgggcgctgtggagtctgctctggcacaggccacgaagaagctctaccag
ggtgaagtggacatccgcgtgtcgattgatcgcgacagcggcgaatacgagactttccgt
cgttggctggtggtgcccgacgatgccggattgcagaaccccgacgccgaagagctgctg
atggatgcccgcgaacgggtggccgatatcgaggtgggggagtacatcgaggaagccgtc
gagtcggtaccgatcggccgcatcggggccatggcggccaagcaggtgatcctgcaaaag
atccgcgatgccgaacgcgagatgctgctcaacgatttcatgtcacgcggcgagaaaatt
ttcaccggcacggtgaaacgcatggacaagggcgacatcatcgtcgagagcggccgggtg
gaagggcgcctgcgtcgcggcgagatgatcccgaaggaaaacctgcgcaatggggaccgt
gtgcgcgccatgatcatggaggtggacctcacgctgcgcggagcgcccatcatcctctcg
cgctccgcgccggagttcatgatcgagttgttccgcaacgaggtgcccgagatcgaacag
ggtctgctggagatcaaaagctgtgcccgtgaccccggcagccgcgcgaagatcgctgtg
ctcagccatgacaagcgcgtggaccccatcggcacctgcgtgggcgtgcgcggaacgcgt
gtgaacgccgtgaccaacgaactggcaggagagcgtgtggacatcgtgctgtggtccgac
gaccctgcgcagttcgtgatcggcgcgcttgctccggccaacgtgacttccatcgtggtc
gacgaagagaagcacgccatggacgtcgtggtggacgaggaaaacctcgccatcgccatc
gggcgcggcggccagaacgtgcgcctggcgtccgacctcacgggctggaagatcaacatc
atggatgcggccgaatccgcgcagaagcaggccaatgaaaccgatgccgcgcgtcgcctg
ttcatggagaagctggatgtggatgaggagatcgccaacatcctgatcgaggagggcttt
gccagcctcgaggaagtggcctatgtgccgctgcaggaaatgctggagatcgagagcttc
gacgaggacacggtgaacgaactgcgcgcacgcgccaaggatgcgctgctcaccatggaa
atcgttcgtgaagaaagcgtggaaagcgtatcgcaagacctgcgtgacctcgaaggtctg
acgcccgaactgatcgccaagttggcggaaggcggcgtgcatacgcgtgacgacctggcc
gatttggccattgacgaactgaccgagctgaccggccagtctgccgaagatgcgaccgcc
ttgatcatgaaggcgcgcgagcactggttcacggggcaagagtaa

DBGET integrated database retrieval system