KEGG   Acidovorax ebreus: Dtpsy_1247
Entry
Dtpsy_1247        CDS       T00853                                 

Definition
(GenBank) translation initiation factor IF-2
  KO
K02519  translation initiation factor IF-2
Organism
dia  Acidovorax ebreus
Brite
KEGG Orthology (KO) [BR:dia00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:dia03012]
    Dtpsy_1247
   03029 Mitochondrial biogenesis [BR:dia03029]
    Dtpsy_1247
Translation factors [BR:dia03012]
 Eukaryotic type
  Initiation factors
   MTIFs
    Dtpsy_1247
 Prokaryotic type
   Dtpsy_1247
Mitochondrial biogenesis [BR:dia03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Dtpsy_1247
SSDB
Motif
Pfam: IF-2 GTP_EFTU IF2_N IF2_assoc GTP_EFTU_D2 MMR_HSR1 Ras FeoB_N Roc
Other DBs
NCBI-ProteinID: ACM32714
UniProt: B9MGP1
Position
1309644..1312475
AA seq 943 aa
MSSNTVAEFAAELKKSPETLLDQLKSAGVVKASPSDVLNEADKQKLLAHLQASHGTAGGD
RKKITLVKKSTSEIKQADASGKARTIQVEVRKKRTFIKRDDSVDAPSDATESAPSAEDLE
LVRREEEARRQAELIRRQEEELALTRREREERERREREAEERAAAYAAQQAEKKAQESAE
RAEAQREAAVEAEERAKAQADARAKADEESKARAAEETARAADLDERRRKALAEAEAIRA
MMAAPKKVLVAKKPEEPKPAAKAGASGDAKKGTLHKPATGSGTGARAAAPSAPGGAGKEV
KSAKLSSSWANDTTKKKEIKTRGDSSGGVGRNNWRGGPRGRRGNDRDDQRQQQAATEFRV
LEVYVPETITVAELAHKMAIKASEVIKSLMKMGQMVTINQPLDQDTAMIVVEEMGHTAKV
AALDDPEAFTAEEVSSQDAEQLSRAPVVTVMGHVDHGKTSLLDYIRRSKVASGEAGGITQ
HIGAYHVETPRGIVTFLDTPGHEAFTAMRARGAQATDIVILVCAADDGVMPQTKEAIKHA
KAAGVPIVVALTKADKPEANIERVKQELVGEQVVPEEYGGDSPFVAVSSKTGMGIDALLE
QVLLQAEVLELKAPVDAAAKGIVIEAQLDKGRGSVATVLVQSGTLKVGDVVLAGQTFGRV
RAMLDEDGKQTKEAGPSIPVEIQGLNEVPQAGDDFMVLQDERRAREIATYRAGKFRNTKL
AKQQAAKLENMFAEMGAGEVQTLPLIIKADVQGSQEALAASLLKLSTEEIRVQIVYSGVG
GISESDVNLAIASKAIVIGFNVRADAQARKTAEGNDVDIRYYNIIYDAVDEVKAAMSGML
APEQREEAIGTAEIRTVFVASKIGTVAGSYITSGQVTRNCKFRLLRDNIVIYTGDVESVR
RMKDDVKEVKEGFECGIKLKNYNDIKEGDQLEFFEIKEIARTL
NT seq 2832 nt   +upstreamnt  +downstreamnt
atgtcgagtaacactgttgctgagttcgctgcagagctcaagaaatcgcctgaaaccttg
ctggaccagctgaagtccgccggtgtggtcaaggcgtcgccgtcggacgttctaaacgaa
gccgacaagcaaaagctgctggcccacctgcaggccagtcatggcactgcggggggggac
cgcaaaaagatcaccctggtcaagaagtccaccagcgagatcaagcaggccgacgcttct
ggcaaggcacgcacgatccaggtcgaagtgcgtaagaagcgtactttcatcaagcgtgac
gacagtgtcgacgcgccttccgatgcgactgaatctgctccttcggcggaggatctcgag
ctcgtgcgccgcgaggaagaggcgcgccgtcaggcagagctgattcgccgccaggaggaa
gagttggccttgacacgccgcgagcgtgaagagcgcgagcgccgcgagcgcgaagccgaa
gaacgcgctgccgcctatgccgcccagcaggcggaaaagaaggcgcaggagtctgcggag
cgtgccgaggcgcagcgcgaagctgccgtggaggccgaagaacgtgcgaaggcacaggcc
gatgcccgggcaaaggccgatgaagaatccaaggcacgcgcggcggaagaaactgcacgt
gcggccgacctggacgagcgccgccgcaaggcgcttgccgaggccgaggccattcgcgca
atgatggctgcccccaagaaggtgctcgtggcgaagaagcccgaggaacccaagcctgcc
gccaaggcgggagcttccggggatgccaagaagggtacgctgcacaaacccgccaccggt
tccggcacgggcgcgcgcgccgctgcgccatcggcgccaggcggggcgggcaaggaggtc
aagtcggccaagctgtcgtccagctgggccaacgacacgaccaagaagaaggaaatcaag
acccgcggcgacagcagtggcggcgtgggtcgcaacaactggcgtggcggcccccgcggc
cgccgcggcaatgaccgcgacgaccagcgccagcagcaggcagccacagagttccgcgtg
ctcgaggtctatgtgcccgagaccatcacggtggccgagttggcgcacaagatggccatc
aaggcttccgaagtgatcaagtcgctcatgaagatgggccagatggtcaccatcaaccag
ccgctggaccaggacaccgccatgatcgtggtggaggaaatgggccacaccgcgaaggtg
gccgctctggatgatccggaagccttcaccgccgaggaagtgtccagccaggatgccgaa
caactgtcccgcgcccccgtggtgacggtgatgggccacgtggaccacggcaagacctca
ctgctggactacatccggcgcagcaaggtagcctctggcgaagctggcggcattacccag
cacatcggcgcctaccatgtggagacgccacgcggtatcgtcacgttcctggacacgccg
ggccacgaggccttcacggccatgcgtgcgcgcggcgcccaggccaccgacatcgtgatt
ctggtgtgtgcggcagacgacggcgtgatgccccagaccaaggaagccatcaagcacgcg
aaggcggctggtgttcccatcgtggtggcgcttaccaaggcagacaagcccgaggccaac
atcgagcgcgtcaagcaggaactggtgggcgagcaggtggtgcctgaggaatacggcggc
gattcgccattcgtggccgtgtcgtccaagacgggcatgggcatcgatgctctgctggag
caggtgctgctccaggccgaggtgctggaactcaaggctcccgtcgatgcggctgccaag
ggtatcgtcatcgaggcccaactggacaagggccgcgggtccgtggctaccgtgctggtg
cagtccggtacgctcaaggtgggcgatgtggtgctggcaggccagactttcggccgcgtg
cgcgccatgctggacgaagacggcaagcagaccaaggaagccggcccgtcgatcccggtg
gagatccagggcctgaacgaagtgccccaggcgggcgacgacttcatggtgctgcaggac
gaacgccgcgcccgcgagatcgcgacgtaccgcgctggcaagttccgcaacaccaagctg
gccaagcaacaggcggccaagctggagaacatgtttgccgagatgggggcgggcgaggtg
cagaccctgccgctgatcatcaaggcggacgtgcagggctcccaggaggcgctggcggct
tcgctgctcaagctctccaccgaagagatccgcgtgcagatcgtgtactccggcgtgggc
ggcatcagcgagtcggacgtcaacctggcgatcgcctccaaggccatcgtcattggcttc
aacgtgcgcgccgatgcgcaggcccgcaaaacggccgaaggcaacgacgtggacatccgc
tactacaacatcatctacgacgccgtggatgaagtgaaggcagcgatgtccggcatgctg
gcgcccgaacagcgcgaggaagccatcggcacggccgagatccgtaccgtgttcgtggcc
tccaagatcggtaccgtggcgggttcgtacatcacgtcgggccaggtcacgcgcaactgc
aagttccgcctgctgcgcgacaacatcgtcatctacacgggcgatgtggaatcggtgcgc
cgcatgaaggacgacgtcaaggaagtcaaggaaggcttcgagtgcggtatcaagctcaag
aactacaacgacatcaaggaaggtgatcagctggagttcttcgagatcaaggaaatcgca
cgcacgctgtaa

DBGET integrated database retrieval system