KEGG   Acidovorax ebreus: Dtpsy_1248
Entry
Dtpsy_1248        CDS       T00853                                 

Definition
(GenBank) ribosome-binding factor A
  KO
K02834  ribosome-binding factor A
Organism
dia  Acidovorax ebreus
Brite
KEGG Orthology (KO) [BR:dia00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:dia03009]
    Dtpsy_1248
Ribosome biogenesis [BR:dia03009]
 Prokaryotic type
  Other maturation factors
   Dtpsy_1248
SSDB
Motif
Pfam: RBFA
Other DBs
NCBI-ProteinID: ACM32715
UniProt: B9MGP2
Position
1312488..1312865
AA seq 125 aa
MAAKKSSSPNRGFKVADQIQRDLTELIRDLKDPRIGMVTLQGVEVTPDYAHAKVFFSVLI
GDGEASEEALNQAGGFLRNGLFKRLHIHTVPTLHFVYDRTTEKAADMNALIARAVASRSK
DDDAA
NT seq 378 nt   +upstreamnt  +downstreamnt
atggctgccaagaaatcctcttcccccaaccgcggcttcaaggtcgcggaccagatccag
cgcgacctcaccgagctgatccgcgatctcaaggatccgcggatcggaatggtgacgctg
caaggggtcgaggtgacgccggactatgcgcacgccaaggtgttcttcagtgtgctcatc
ggtgatggtgaggcctccgaggaggccctgaaccaggcgggtggctttctacgcaacggc
ctgttcaagcgcctgcacatccacaccgtgcccacgctgcacttcgtgtacgaccgcacc
accgagaaggcggccgacatgaatgcgctgatcgcgcgcgcggtggcctctcgttccaaa
gacgacgacgcagcatga

DBGET integrated database retrieval system