KEGG   Acidovorax ebreus: Dtpsy_1249
Entry
Dtpsy_1249        CDS       T00853                                 

Definition
(GenBank) tRNA pseudouridine synthase B
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
dia  Acidovorax ebreus
Brite
KEGG Orthology (KO) [BR:dia00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dia03016]
    Dtpsy_1249
Enzymes [BR:dia01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     Dtpsy_1249
Transfer RNA biogenesis [BR:dia03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    Dtpsy_1249
 Prokaryotic type
    Dtpsy_1249
SSDB
Motif
Pfam: TruB_N TruB_C_2 TruB-C_2
Other DBs
NCBI-ProteinID: ACM32716
UniProt: B9MGP3
Position
1312862..1313863
AA seq 333 aa
MTERAPRIRVQRRPVHGVLLLDKPLGLSSNDALQKVKWLLRAEKAGHTGTLDPLASGVLP
LCFGAATKFSQLQLEAPKAYEAVALLGTTTSTGDAEGQVLAQCAVDPAMLTPERLLAVQA
QFTGPIRQVPPMHSALKKDGKALYEYARAGIAVEREARDVTIHALKLALTHTEQAQPAIK
IVVTCSKGTYIRTLGEDIGQALGCGAHLTFLRRTDTGGIGVERCVTLEALQAMDEDARMA
CVHPVETLLAQHTAVTLDDDNAGRFLSGMRRRGPWPDAPAVAVFGARPRVLLGVGHVRGG
ELIPDRLLSPLEIQQILESSPRAERGTLEATTL
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgaccgaacgcgctccccgcatccgggtgcagcggcgcccggtgcacggagtgctgctg
ctcgacaaacccctgggcctgtccagcaacgacgccttgcagaaggtgaagtggctgctg
cgcgccgagaaggctggccacacgggcacgctggacccgctggccagtggcgtgctgccg
ctgtgctttggtgccgccaccaaattcagccagttgcagctggaagcgcccaaggcctat
gaagccgtcgcactgttgggtactaccacaagcactggtgacgccgagggtcaggtgctg
gcgcagtgcgcggtcgatccggccatgctcacgcccgagcgactgttggcggtacaggcc
cagttcaccggccccatccgccaggtgccgcccatgcacagcgcgctcaagaaagacggc
aaggcgctgtacgagtacgcgcgtgccggcatcgccgtggagcgcgaggcgcgtgatgtc
acgattcatgcattaaaactggcgctaacgcatacggagcaagcgcaaccagctattaaa
atagtagtgacctgcagcaagggtacctacatccgtaccctgggtgaagacatcggccag
gcgctgggctgcggcgcgcatctcacgttcctgcgccgtaccgacacgggcggtatcggc
gtggagcgctgcgtgacactggaggcgctgcaggccatggacgaggatgcgcgcatggcc
tgcgtgcacccggtggagaccttgctggcgcagcacacggctgtcacgctggacgatgac
aatgccgggcgtttcctctcgggcatgcgccggcgcggcccctggcccgacgcgcccgcc
gtggccgtgttcggggcgcgcccgcgcgtgctgctgggggtcgggcatgtgcggggagga
gagctgattccagaccggctgctcagcccccttgaaattcaacagattctggagagctcg
ccgcgggctgaacgcggcacattggaagcaactacgctatga

DBGET integrated database retrieval system